BLASTX nr result
ID: Mentha26_contig00019312
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00019312 (453 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU32311.1| hypothetical protein MIMGU_mgv1a006875mg [Mimulus... 60 2e-07 >gb|EYU32311.1| hypothetical protein MIMGU_mgv1a006875mg [Mimulus guttatus] Length = 428 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/38 (73%), Positives = 31/38 (81%) Frame = +2 Query: 2 NVFNNTHMPSTSFSPAVVGKGNTSKPMLSMEANANHSH 115 NV NN+H PSTS SPAVVGKGN SKP+LS EANA H + Sbjct: 370 NVLNNSHAPSTSQSPAVVGKGNASKPILSTEANATHGN 407