BLASTX nr result
ID: Mentha26_contig00019181
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00019181 (543 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU33078.1| hypothetical protein MIMGU_mgv1a000776mg [Mimulus... 57 4e-06 gb|EXB94379.1| E3 ubiquitin-protein ligase UPL6 [Morus notabilis] 56 7e-06 ref|XP_006600390.1| PREDICTED: E3 ubiquitin-protein ligase UPL6-... 56 7e-06 ref|XP_007035898.1| Ubiquitin protein ligase 6 isoform 5 [Theobr... 56 7e-06 ref|XP_007035897.1| Ubiquitin protein ligase 6 isoform 4 [Theobr... 56 7e-06 ref|XP_007035896.1| Ubiquitin protein ligase 6 isoform 3 [Theobr... 56 7e-06 ref|XP_007035895.1| Ubiquitin protein ligase 6 isoform 2 [Theobr... 56 7e-06 ref|XP_007035894.1| Ubiquitin protein ligase 6 isoform 1 [Theobr... 56 7e-06 ref|XP_004295041.1| PREDICTED: E3 ubiquitin-protein ligase UPL6-... 56 7e-06 ref|XP_007225398.1| hypothetical protein PRUPE_ppa000674mg [Prun... 56 7e-06 ref|XP_003550723.1| PREDICTED: E3 ubiquitin-protein ligase UPL6-... 56 7e-06 ref|XP_003529499.1| PREDICTED: E3 ubiquitin-protein ligase UPL6-... 56 7e-06 ref|XP_002519280.1| ubiquitin-protein ligase, putative [Ricinus ... 56 7e-06 ref|XP_003594658.1| E3 ubiquitin-protein ligase UPL6 [Medicago t... 55 9e-06 >gb|EYU33078.1| hypothetical protein MIMGU_mgv1a000776mg [Mimulus guttatus] Length = 988 Score = 56.6 bits (135), Expect = 4e-06 Identities = 30/42 (71%), Positives = 31/42 (73%), Gaps = 9/42 (21%) Frame = +1 Query: 1 IRITFVNEFG---------GIFKDFMVNISRLAFDIQYGLFK 99 IRITFVNEFG GIFKDFM NI+R AFDIQYGLFK Sbjct: 698 IRITFVNEFGVEEAGIDGGGIFKDFMENITRAAFDIQYGLFK 739 >gb|EXB94379.1| E3 ubiquitin-protein ligase UPL6 [Morus notabilis] Length = 1413 Score = 55.8 bits (133), Expect = 7e-06 Identities = 28/42 (66%), Positives = 31/42 (73%), Gaps = 9/42 (21%) Frame = +1 Query: 1 IRITFVNEFG---------GIFKDFMVNISRLAFDIQYGLFK 99 IR+TFVNEFG GIFKDFM NI+R AFD+QYGLFK Sbjct: 702 IRVTFVNEFGVEEAGIDGGGIFKDFMENITRAAFDVQYGLFK 743 >ref|XP_006600390.1| PREDICTED: E3 ubiquitin-protein ligase UPL6-like isoform X2 [Glycine max] Length = 1020 Score = 55.8 bits (133), Expect = 7e-06 Identities = 28/42 (66%), Positives = 31/42 (73%), Gaps = 9/42 (21%) Frame = +1 Query: 1 IRITFVNEFG---------GIFKDFMVNISRLAFDIQYGLFK 99 IR+TFVNEFG GIFKDFM NI+R AFD+QYGLFK Sbjct: 693 IRVTFVNEFGVEEAGIDGGGIFKDFMENITRAAFDVQYGLFK 734 >ref|XP_007035898.1| Ubiquitin protein ligase 6 isoform 5 [Theobroma cacao] gi|508714927|gb|EOY06824.1| Ubiquitin protein ligase 6 isoform 5 [Theobroma cacao] Length = 920 Score = 55.8 bits (133), Expect = 7e-06 Identities = 28/42 (66%), Positives = 31/42 (73%), Gaps = 9/42 (21%) Frame = +1 Query: 1 IRITFVNEFG---------GIFKDFMVNISRLAFDIQYGLFK 99 IR+TFVNEFG GIFKDFM NI+R AFD+QYGLFK Sbjct: 703 IRVTFVNEFGVEEAGIDGGGIFKDFMENITRAAFDVQYGLFK 744 >ref|XP_007035897.1| Ubiquitin protein ligase 6 isoform 4 [Theobroma cacao] gi|508714926|gb|EOY06823.1| Ubiquitin protein ligase 6 isoform 4 [Theobroma cacao] Length = 861 Score = 55.8 bits (133), Expect = 7e-06 Identities = 28/42 (66%), Positives = 31/42 (73%), Gaps = 9/42 (21%) Frame = +1 Query: 1 IRITFVNEFG---------GIFKDFMVNISRLAFDIQYGLFK 99 IR+TFVNEFG GIFKDFM NI+R AFD+QYGLFK Sbjct: 528 IRVTFVNEFGVEEAGIDGGGIFKDFMENITRAAFDVQYGLFK 569 >ref|XP_007035896.1| Ubiquitin protein ligase 6 isoform 3 [Theobroma cacao] gi|508714925|gb|EOY06822.1| Ubiquitin protein ligase 6 isoform 3 [Theobroma cacao] Length = 961 Score = 55.8 bits (133), Expect = 7e-06 Identities = 28/42 (66%), Positives = 31/42 (73%), Gaps = 9/42 (21%) Frame = +1 Query: 1 IRITFVNEFG---------GIFKDFMVNISRLAFDIQYGLFK 99 IR+TFVNEFG GIFKDFM NI+R AFD+QYGLFK Sbjct: 703 IRVTFVNEFGVEEAGIDGGGIFKDFMENITRAAFDVQYGLFK 744 >ref|XP_007035895.1| Ubiquitin protein ligase 6 isoform 2 [Theobroma cacao] gi|508714924|gb|EOY06821.1| Ubiquitin protein ligase 6 isoform 2 [Theobroma cacao] Length = 1036 Score = 55.8 bits (133), Expect = 7e-06 Identities = 28/42 (66%), Positives = 31/42 (73%), Gaps = 9/42 (21%) Frame = +1 Query: 1 IRITFVNEFG---------GIFKDFMVNISRLAFDIQYGLFK 99 IR+TFVNEFG GIFKDFM NI+R AFD+QYGLFK Sbjct: 703 IRVTFVNEFGVEEAGIDGGGIFKDFMENITRAAFDVQYGLFK 744 >ref|XP_007035894.1| Ubiquitin protein ligase 6 isoform 1 [Theobroma cacao] gi|508714923|gb|EOY06820.1| Ubiquitin protein ligase 6 isoform 1 [Theobroma cacao] Length = 1035 Score = 55.8 bits (133), Expect = 7e-06 Identities = 28/42 (66%), Positives = 31/42 (73%), Gaps = 9/42 (21%) Frame = +1 Query: 1 IRITFVNEFG---------GIFKDFMVNISRLAFDIQYGLFK 99 IR+TFVNEFG GIFKDFM NI+R AFD+QYGLFK Sbjct: 702 IRVTFVNEFGVEEAGIDGGGIFKDFMENITRAAFDVQYGLFK 743 >ref|XP_004295041.1| PREDICTED: E3 ubiquitin-protein ligase UPL6-like [Fragaria vesca subsp. vesca] Length = 1035 Score = 55.8 bits (133), Expect = 7e-06 Identities = 28/42 (66%), Positives = 31/42 (73%), Gaps = 9/42 (21%) Frame = +1 Query: 1 IRITFVNEFG---------GIFKDFMVNISRLAFDIQYGLFK 99 IR+TFVNEFG GIFKDFM NI+R AFD+QYGLFK Sbjct: 702 IRVTFVNEFGVEEAGIDGGGIFKDFMENITRAAFDVQYGLFK 743 >ref|XP_007225398.1| hypothetical protein PRUPE_ppa000674mg [Prunus persica] gi|462422334|gb|EMJ26597.1| hypothetical protein PRUPE_ppa000674mg [Prunus persica] Length = 1039 Score = 55.8 bits (133), Expect = 7e-06 Identities = 28/42 (66%), Positives = 31/42 (73%), Gaps = 9/42 (21%) Frame = +1 Query: 1 IRITFVNEFG---------GIFKDFMVNISRLAFDIQYGLFK 99 IR+TFVNEFG GIFKDFM NI+R AFD+QYGLFK Sbjct: 706 IRVTFVNEFGVEEAGIDGGGIFKDFMENITRAAFDVQYGLFK 747 >ref|XP_003550723.1| PREDICTED: E3 ubiquitin-protein ligase UPL6-like isoformX1 [Glycine max] Length = 1026 Score = 55.8 bits (133), Expect = 7e-06 Identities = 28/42 (66%), Positives = 31/42 (73%), Gaps = 9/42 (21%) Frame = +1 Query: 1 IRITFVNEFG---------GIFKDFMVNISRLAFDIQYGLFK 99 IR+TFVNEFG GIFKDFM NI+R AFD+QYGLFK Sbjct: 693 IRVTFVNEFGVEEAGIDGGGIFKDFMENITRAAFDVQYGLFK 734 >ref|XP_003529499.1| PREDICTED: E3 ubiquitin-protein ligase UPL6-like isoform 1 [Glycine max] Length = 1026 Score = 55.8 bits (133), Expect = 7e-06 Identities = 28/42 (66%), Positives = 31/42 (73%), Gaps = 9/42 (21%) Frame = +1 Query: 1 IRITFVNEFG---------GIFKDFMVNISRLAFDIQYGLFK 99 IR+TFVNEFG GIFKDFM NI+R AFD+QYGLFK Sbjct: 693 IRVTFVNEFGVEEAGIDGGGIFKDFMENITRAAFDVQYGLFK 734 >ref|XP_002519280.1| ubiquitin-protein ligase, putative [Ricinus communis] gi|223541595|gb|EEF43144.1| ubiquitin-protein ligase, putative [Ricinus communis] Length = 1067 Score = 55.8 bits (133), Expect = 7e-06 Identities = 28/42 (66%), Positives = 31/42 (73%), Gaps = 9/42 (21%) Frame = +1 Query: 1 IRITFVNEFG---------GIFKDFMVNISRLAFDIQYGLFK 99 IR+TFVNEFG GIFKDFM NI+R AFD+QYGLFK Sbjct: 701 IRVTFVNEFGVEEAGIDGGGIFKDFMENITRAAFDVQYGLFK 742 >ref|XP_003594658.1| E3 ubiquitin-protein ligase UPL6 [Medicago truncatula] gi|355483706|gb|AES64909.1| E3 ubiquitin-protein ligase UPL6 [Medicago truncatula] Length = 1103 Score = 55.5 bits (132), Expect = 9e-06 Identities = 28/49 (57%), Positives = 34/49 (69%), Gaps = 9/49 (18%) Frame = +1 Query: 1 IRITFVNEFG---------GIFKDFMVNISRLAFDIQYGLFKVVIYVMI 120 IR+TFVNEFG GIFKDFM NI+R +FD+QYGLFK+ M+ Sbjct: 691 IRVTFVNEFGVEEAGIDGGGIFKDFMENITRASFDVQYGLFKLAPRCML 739