BLASTX nr result
ID: Mentha26_contig00019060
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00019060 (362 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU28826.1| hypothetical protein MIMGU_mgv1a009546mg [Mimulus... 100 2e-19 >gb|EYU28826.1| hypothetical protein MIMGU_mgv1a009546mg [Mimulus guttatus] Length = 339 Score = 100 bits (249), Expect = 2e-19 Identities = 51/83 (61%), Positives = 60/83 (72%) Frame = -2 Query: 250 MVQNSINTLVTSRCSVVCGSNDWSRRSSSQVRDSYLVLGASRSCLCAYNGRGASFAGPCK 71 MVQ +INTLVTSRCSVVC S++ RR+ VR+ + VLGA RSCLC+ + ASF GPC Sbjct: 1 MVQVAINTLVTSRCSVVCESSNLWRRNFGVVREHHAVLGAGRSCLCSSVEKDASFVGPCH 60 Query: 70 KFPRSGLRVQAGWLFRGNDKGSE 2 P LRVQA WLF G+DKGSE Sbjct: 61 VSPPRSLRVQARWLFNGSDKGSE 83