BLASTX nr result
ID: Mentha26_contig00018940
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00018940 (366 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002320871.2| hypothetical protein POPTR_0014s09520g [Popu... 56 5e-06 gb|EYU32259.1| hypothetical protein MIMGU_mgv1a021930mg [Mimulus... 55 8e-06 >ref|XP_002320871.2| hypothetical protein POPTR_0014s09520g [Populus trichocarpa] gi|550323841|gb|EEE99186.2| hypothetical protein POPTR_0014s09520g [Populus trichocarpa] Length = 619 Score = 56.2 bits (134), Expect = 5e-06 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = +2 Query: 2 ERVFHTFVVKSHGSERLTKEKLIDAFSRKSSSPHQLS 112 + VFHTFV+KS GSE+LTKEKL+ AFSR+SSS H LS Sbjct: 580 DTVFHTFVIKSQGSEQLTKEKLMAAFSRESSSLHSLS 616 >gb|EYU32259.1| hypothetical protein MIMGU_mgv1a021930mg [Mimulus guttatus] Length = 500 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/32 (81%), Positives = 31/32 (96%) Frame = +2 Query: 2 ERVFHTFVVKSHGSERLTKEKLIDAFSRKSSS 97 ERVFHTFVVKS+GS+RLTKEK+I+AFSR S+S Sbjct: 468 ERVFHTFVVKSNGSDRLTKEKMIEAFSRGSNS 499