BLASTX nr result
ID: Mentha26_contig00018915
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00018915 (358 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI32677.3| unnamed protein product [Vitis vinifera] 84 2e-14 ref|XP_002278566.1| PREDICTED: diaminopimelate epimerase, chloro... 84 2e-14 ref|XP_007205407.1| hypothetical protein PRUPE_ppa007581mg [Prun... 83 3e-14 gb|EYU41679.1| hypothetical protein MIMGU_mgv1a008693mg [Mimulus... 81 2e-13 ref|XP_004246745.1| PREDICTED: diaminopimelate epimerase, chloro... 81 2e-13 ref|XP_006844286.1| hypothetical protein AMTR_s00145p00090730 [A... 80 4e-13 gb|EYU28264.1| hypothetical protein MIMGU_mgv1a008687mg [Mimulus... 79 5e-13 ref|XP_006410926.1| hypothetical protein EUTSA_v10016845mg [Eutr... 79 5e-13 ref|XP_007027115.1| Diaminopimelate epimerase family protein iso... 79 5e-13 ref|XP_004302726.1| PREDICTED: diaminopimelate epimerase, chloro... 79 5e-13 ref|XP_004173638.1| PREDICTED: diaminopimelate epimerase, chloro... 79 5e-13 ref|XP_004142088.1| PREDICTED: diaminopimelate epimerase, chloro... 79 5e-13 gb|ACR35767.1| unknown [Zea mays] 79 5e-13 ref|NP_001141344.1| uncharacterized protein LOC100273435 [Zea ma... 79 5e-13 gb|ACF84249.1| unknown [Zea mays] 79 5e-13 ref|XP_002308231.2| hypothetical protein POPTR_0006s10360g [Popu... 79 7e-13 ref|XP_006374003.1| hypothetical protein POPTR_0016s12850g [Popu... 79 7e-13 ref|XP_002323003.2| hypothetical protein POPTR_0016s12850g [Popu... 79 7e-13 ref|NP_190926.1| diaminopimelate epimerase [Arabidopsis thaliana... 79 7e-13 ref|XP_002876213.1| diaminopimelate epimerase family protein [Ar... 79 7e-13 >emb|CBI32677.3| unnamed protein product [Vitis vinifera] Length = 307 Score = 84.3 bits (207), Expect = 2e-14 Identities = 35/41 (85%), Positives = 38/41 (92%) Frame = +1 Query: 1 ADRKCTVDLPGGPLDIEWRESDNHIYMTGPAELVFYGSIPL 123 A R CTVDLPGGPLDIEWRE DNH+YMTGPAE+VFYGS+PL Sbjct: 267 AGRSCTVDLPGGPLDIEWREEDNHVYMTGPAEIVFYGSVPL 307 >ref|XP_002278566.1| PREDICTED: diaminopimelate epimerase, chloroplastic [Vitis vinifera] Length = 370 Score = 84.3 bits (207), Expect = 2e-14 Identities = 35/41 (85%), Positives = 38/41 (92%) Frame = +1 Query: 1 ADRKCTVDLPGGPLDIEWRESDNHIYMTGPAELVFYGSIPL 123 A R CTVDLPGGPLDIEWRE DNH+YMTGPAE+VFYGS+PL Sbjct: 330 AGRSCTVDLPGGPLDIEWREEDNHVYMTGPAEIVFYGSVPL 370 >ref|XP_007205407.1| hypothetical protein PRUPE_ppa007581mg [Prunus persica] gi|462401049|gb|EMJ06606.1| hypothetical protein PRUPE_ppa007581mg [Prunus persica] Length = 363 Score = 83.2 bits (204), Expect = 3e-14 Identities = 35/41 (85%), Positives = 38/41 (92%) Frame = +1 Query: 1 ADRKCTVDLPGGPLDIEWRESDNHIYMTGPAELVFYGSIPL 123 A+R CTVDLPGGPL IEWRE DNHIYMTGPAE+VFYGS+PL Sbjct: 323 AERNCTVDLPGGPLQIEWREEDNHIYMTGPAEVVFYGSVPL 363 >gb|EYU41679.1| hypothetical protein MIMGU_mgv1a008693mg [Mimulus guttatus] Length = 365 Score = 80.9 bits (198), Expect = 2e-13 Identities = 33/41 (80%), Positives = 38/41 (92%) Frame = +1 Query: 1 ADRKCTVDLPGGPLDIEWRESDNHIYMTGPAELVFYGSIPL 123 A+R C V+LPGGPLDIEWRE DNHIYMTGPA++VFYGS+PL Sbjct: 325 AERSCRVELPGGPLDIEWREEDNHIYMTGPAQIVFYGSVPL 365 >ref|XP_004246745.1| PREDICTED: diaminopimelate epimerase, chloroplastic-like [Solanum lycopersicum] Length = 363 Score = 80.9 bits (198), Expect = 2e-13 Identities = 35/41 (85%), Positives = 37/41 (90%) Frame = +1 Query: 1 ADRKCTVDLPGGPLDIEWRESDNHIYMTGPAELVFYGSIPL 123 A R+CTVDLPGGPLDIEW E DNHIYMTGPAE+VFYGS PL Sbjct: 323 AARRCTVDLPGGPLDIEWSEKDNHIYMTGPAEVVFYGSAPL 363 >ref|XP_006844286.1| hypothetical protein AMTR_s00145p00090730 [Amborella trichopoda] gi|548846695|gb|ERN05961.1| hypothetical protein AMTR_s00145p00090730 [Amborella trichopoda] Length = 386 Score = 79.7 bits (195), Expect = 4e-13 Identities = 33/41 (80%), Positives = 38/41 (92%) Frame = +1 Query: 1 ADRKCTVDLPGGPLDIEWRESDNHIYMTGPAELVFYGSIPL 123 ++RKC VDLPGG L+IEWRE DNH+YMTGPAELVFYGS+PL Sbjct: 346 SERKCAVDLPGGLLEIEWREDDNHVYMTGPAELVFYGSVPL 386 >gb|EYU28264.1| hypothetical protein MIMGU_mgv1a008687mg [Mimulus guttatus] Length = 365 Score = 79.3 bits (194), Expect = 5e-13 Identities = 33/39 (84%), Positives = 38/39 (97%) Frame = +1 Query: 1 ADRKCTVDLPGGPLDIEWRESDNHIYMTGPAELVFYGSI 117 A+R CTVDLPGGPLDIEWRE+DNH+YMTGPAELVF+GS+ Sbjct: 325 AERICTVDLPGGPLDIEWREADNHVYMTGPAELVFHGSV 363 >ref|XP_006410926.1| hypothetical protein EUTSA_v10016845mg [Eutrema salsugineum] gi|557112095|gb|ESQ52379.1| hypothetical protein EUTSA_v10016845mg [Eutrema salsugineum] Length = 363 Score = 79.3 bits (194), Expect = 5e-13 Identities = 33/37 (89%), Positives = 36/37 (97%) Frame = +1 Query: 4 DRKCTVDLPGGPLDIEWRESDNHIYMTGPAELVFYGS 114 DRKCTVDLPGGPL+IEW+E DNHIYMTGPA+LVFYGS Sbjct: 322 DRKCTVDLPGGPLEIEWKEEDNHIYMTGPADLVFYGS 358 >ref|XP_007027115.1| Diaminopimelate epimerase family protein isoform 1 [Theobroma cacao] gi|508715720|gb|EOY07617.1| Diaminopimelate epimerase family protein isoform 1 [Theobroma cacao] Length = 361 Score = 79.3 bits (194), Expect = 5e-13 Identities = 33/41 (80%), Positives = 37/41 (90%) Frame = +1 Query: 1 ADRKCTVDLPGGPLDIEWRESDNHIYMTGPAELVFYGSIPL 123 A R CTVDLPGG L+IEWRE DNH+YMTGPAE+VFYGS+PL Sbjct: 321 AGRSCTVDLPGGTLEIEWREEDNHVYMTGPAEVVFYGSVPL 361 >ref|XP_004302726.1| PREDICTED: diaminopimelate epimerase, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 362 Score = 79.3 bits (194), Expect = 5e-13 Identities = 34/41 (82%), Positives = 36/41 (87%) Frame = +1 Query: 1 ADRKCTVDLPGGPLDIEWRESDNHIYMTGPAELVFYGSIPL 123 A R CTVDLPGGPL IEW E DNHIYMTGPAE+VFYGS+PL Sbjct: 322 AARNCTVDLPGGPLQIEWSEEDNHIYMTGPAEVVFYGSVPL 362 >ref|XP_004173638.1| PREDICTED: diaminopimelate epimerase, chloroplastic-like, partial [Cucumis sativus] Length = 172 Score = 79.3 bits (194), Expect = 5e-13 Identities = 33/41 (80%), Positives = 36/41 (87%) Frame = +1 Query: 1 ADRKCTVDLPGGPLDIEWRESDNHIYMTGPAELVFYGSIPL 123 A R CTVDLPGGPL IEW E DNH+YMTGPAE+VFYGS+PL Sbjct: 131 AGRNCTVDLPGGPLQIEWSEEDNHVYMTGPAEVVFYGSVPL 171 >ref|XP_004142088.1| PREDICTED: diaminopimelate epimerase, chloroplastic-like [Cucumis sativus] Length = 364 Score = 79.3 bits (194), Expect = 5e-13 Identities = 33/41 (80%), Positives = 36/41 (87%) Frame = +1 Query: 1 ADRKCTVDLPGGPLDIEWRESDNHIYMTGPAELVFYGSIPL 123 A R CTVDLPGGPL IEW E DNH+YMTGPAE+VFYGS+PL Sbjct: 323 AGRNCTVDLPGGPLQIEWSEEDNHVYMTGPAEVVFYGSVPL 363 >gb|ACR35767.1| unknown [Zea mays] Length = 350 Score = 79.3 bits (194), Expect = 5e-13 Identities = 32/39 (82%), Positives = 37/39 (94%) Frame = +1 Query: 1 ADRKCTVDLPGGPLDIEWRESDNHIYMTGPAELVFYGSI 117 A+RKC VDLPGGPL+IEWRE DNH+YMTGPAE+VFYGS+ Sbjct: 310 AERKCVVDLPGGPLEIEWREDDNHVYMTGPAEVVFYGSV 348 >ref|NP_001141344.1| uncharacterized protein LOC100273435 [Zea mays] gi|194704094|gb|ACF86131.1| unknown [Zea mays] gi|223948299|gb|ACN28233.1| unknown [Zea mays] gi|414878077|tpg|DAA55208.1| TPA: hypothetical protein ZEAMMB73_842737 [Zea mays] Length = 353 Score = 79.3 bits (194), Expect = 5e-13 Identities = 32/39 (82%), Positives = 37/39 (94%) Frame = +1 Query: 1 ADRKCTVDLPGGPLDIEWRESDNHIYMTGPAELVFYGSI 117 A+RKC VDLPGGPL+IEWRE DNH+YMTGPAE+VFYGS+ Sbjct: 313 AERKCVVDLPGGPLEIEWREDDNHVYMTGPAEVVFYGSV 351 >gb|ACF84249.1| unknown [Zea mays] Length = 308 Score = 79.3 bits (194), Expect = 5e-13 Identities = 32/39 (82%), Positives = 37/39 (94%) Frame = +1 Query: 1 ADRKCTVDLPGGPLDIEWRESDNHIYMTGPAELVFYGSI 117 A+RKC VDLPGGPL+IEWRE DNH+YMTGPAE+VFYGS+ Sbjct: 268 AERKCVVDLPGGPLEIEWREDDNHVYMTGPAEVVFYGSV 306 >ref|XP_002308231.2| hypothetical protein POPTR_0006s10360g [Populus trichocarpa] gi|550335915|gb|EEE91754.2| hypothetical protein POPTR_0006s10360g [Populus trichocarpa] Length = 366 Score = 79.0 bits (193), Expect = 7e-13 Identities = 33/41 (80%), Positives = 37/41 (90%) Frame = +1 Query: 1 ADRKCTVDLPGGPLDIEWRESDNHIYMTGPAELVFYGSIPL 123 A R CTVDLPGGPL+IEWRE DNH+YMTGPAE+VFYGS+ L Sbjct: 326 AGRNCTVDLPGGPLEIEWREEDNHVYMTGPAEVVFYGSVRL 366 >ref|XP_006374003.1| hypothetical protein POPTR_0016s12850g [Populus trichocarpa] gi|550321383|gb|ERP51800.1| hypothetical protein POPTR_0016s12850g [Populus trichocarpa] Length = 368 Score = 79.0 bits (193), Expect = 7e-13 Identities = 33/41 (80%), Positives = 37/41 (90%) Frame = +1 Query: 1 ADRKCTVDLPGGPLDIEWRESDNHIYMTGPAELVFYGSIPL 123 A R CTVDLPGGPL+IEWRE DNH+YMTGPAE+VF GS+PL Sbjct: 323 AGRNCTVDLPGGPLEIEWREEDNHVYMTGPAEMVFDGSVPL 363 >ref|XP_002323003.2| hypothetical protein POPTR_0016s12850g [Populus trichocarpa] gi|550321382|gb|EEF04764.2| hypothetical protein POPTR_0016s12850g [Populus trichocarpa] Length = 363 Score = 79.0 bits (193), Expect = 7e-13 Identities = 33/41 (80%), Positives = 37/41 (90%) Frame = +1 Query: 1 ADRKCTVDLPGGPLDIEWRESDNHIYMTGPAELVFYGSIPL 123 A R CTVDLPGGPL+IEWRE DNH+YMTGPAE+VF GS+PL Sbjct: 318 AGRNCTVDLPGGPLEIEWREEDNHVYMTGPAEMVFDGSVPL 358 >ref|NP_190926.1| diaminopimelate epimerase [Arabidopsis thaliana] gi|75263858|sp|Q9LFG2.1|DAPF_ARATH RecName: Full=Diaminopimelate epimerase, chloroplastic; Short=DAP epimerase; Flags: Precursor gi|6729509|emb|CAB67665.1| diaminopimelate epimerase-like protein [Arabidopsis thaliana] gi|22022530|gb|AAM83223.1| AT3g53580/F4P12_280 [Arabidopsis thaliana] gi|23505901|gb|AAN28810.1| At3g53580/F4P12_280 [Arabidopsis thaliana] gi|332645592|gb|AEE79113.1| diaminopimelate epimerase [Arabidopsis thaliana] Length = 362 Score = 79.0 bits (193), Expect = 7e-13 Identities = 33/38 (86%), Positives = 36/38 (94%) Frame = +1 Query: 1 ADRKCTVDLPGGPLDIEWRESDNHIYMTGPAELVFYGS 114 ADRKCTVDLPGGPL+IEW++ DNHIYMTGPAE VFYGS Sbjct: 322 ADRKCTVDLPGGPLEIEWKQEDNHIYMTGPAEAVFYGS 359 >ref|XP_002876213.1| diaminopimelate epimerase family protein [Arabidopsis lyrata subsp. lyrata] gi|297322051|gb|EFH52472.1| diaminopimelate epimerase family protein [Arabidopsis lyrata subsp. lyrata] Length = 362 Score = 79.0 bits (193), Expect = 7e-13 Identities = 33/38 (86%), Positives = 36/38 (94%) Frame = +1 Query: 1 ADRKCTVDLPGGPLDIEWRESDNHIYMTGPAELVFYGS 114 ADRKCTVDLPGGPL+IEW++ DNHIYMTGPAE VFYGS Sbjct: 322 ADRKCTVDLPGGPLEIEWKQEDNHIYMTGPAEAVFYGS 359