BLASTX nr result
ID: Mentha26_contig00018530
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00018530 (278 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU20909.1| hypothetical protein MIMGU_mgv1a010895mg [Mimulus... 75 9e-12 gb|EYU42408.1| hypothetical protein MIMGU_mgv1a013405mg [Mimulus... 69 9e-10 >gb|EYU20909.1| hypothetical protein MIMGU_mgv1a010895mg [Mimulus guttatus] gi|604301190|gb|EYU20910.1| hypothetical protein MIMGU_mgv1a010895mg [Mimulus guttatus] Length = 298 Score = 75.1 bits (183), Expect = 9e-12 Identities = 41/86 (47%), Positives = 54/86 (62%), Gaps = 1/86 (1%) Frame = -1 Query: 278 EKGSKPLIWRSRGEIYCRAKEVQSHIHMKLVNWINNQLRGRQRIQRQ-HVSPLLPVRSIR 102 EKG +P WRSRG + HM+L+NW+N L G R QRQ HVS ++P+ Sbjct: 228 EKGFRPFFWRSRGG---------NCTHMRLINWMNRHLGGGYRSQRQQHVSQVMPI---- 274 Query: 101 PVKSIRFVLALMLAIFLFVPFVLHST 24 KSIRF+L LML +FL VPF+++ST Sbjct: 275 --KSIRFILVLMLTVFLVVPFLVYST 298 >gb|EYU42408.1| hypothetical protein MIMGU_mgv1a013405mg [Mimulus guttatus] Length = 221 Score = 68.6 bits (166), Expect = 9e-10 Identities = 33/62 (53%), Positives = 45/62 (72%) Frame = -1 Query: 209 SHIHMKLVNWINNQLRGRQRIQRQHVSPLLPVRSIRPVKSIRFVLALMLAIFLFVPFVLH 30 +H +K++NWIN +LRG QR QRQ + +RPV S+RF+LALML IFL VPF+++ Sbjct: 168 NHTQLKMINWINQRLRGGQRGQRQQL--------VRPVNSMRFILALMLTIFLVVPFLVY 219 Query: 29 ST 24 ST Sbjct: 220 ST 221