BLASTX nr result
ID: Mentha26_contig00018489
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00018489 (462 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC32759.1| hypothetical protein L484_019872 [Morus notabilis] 105 7e-21 ref|XP_004291271.1| PREDICTED: cation transport regulator-like p... 104 1e-20 gb|AFK43603.1| unknown [Lotus japonicus] 104 1e-20 ref|XP_006483635.1| PREDICTED: cation transport regulator-like p... 103 3e-20 ref|XP_007223927.1| hypothetical protein PRUPE_ppa011048mg [Prun... 103 3e-20 ref|XP_007011512.1| ChaC family protein-like [Theobroma cacao] g... 102 4e-20 ref|XP_006382203.1| ChaC-like family protein [Populus trichocarp... 102 6e-20 gb|ABK95363.1| unknown [Populus trichocarpa] 102 6e-20 ref|XP_006371827.1| ChaC-like family protein [Populus trichocarp... 102 7e-20 gb|ABK96295.1| unknown [Populus trichocarpa x Populus deltoides] 102 7e-20 ref|XP_006357035.1| PREDICTED: cation transport regulator-like p... 101 9e-20 ref|XP_006450090.1| hypothetical protein CICLE_v10009681mg [Citr... 101 9e-20 ref|XP_006450089.1| hypothetical protein CICLE_v10009681mg [Citr... 101 9e-20 ref|XP_004244472.1| PREDICTED: cation transport regulator-like p... 101 9e-20 ref|XP_004244471.1| PREDICTED: cation transport regulator-like p... 101 9e-20 ref|NP_001275463.1| cation transport regulator-like protein 2-li... 101 9e-20 gb|ABA46779.1| meloidogyne-induced giant cell protein-like prote... 101 9e-20 ref|XP_004501211.1| PREDICTED: cation transport regulator-like p... 101 1e-19 ref|XP_003522674.1| PREDICTED: cation transport regulator-like p... 101 1e-19 emb|CAD38520.1| putative cation transporter [Beta procumbens] 100 2e-19 >gb|EXC32759.1| hypothetical protein L484_019872 [Morus notabilis] Length = 226 Score = 105 bits (262), Expect = 7e-21 Identities = 46/47 (97%), Positives = 46/47 (97%) Frame = -3 Query: 142 MVFWVFGYGSLVWNPGFEVDEKVIGFIKDYRRVFDLACIDHRGTPEH 2 MVFWVFGYGSLVWNPGFE DEKVIGFIKDYRRVFDLACIDHRGTPEH Sbjct: 1 MVFWVFGYGSLVWNPGFEYDEKVIGFIKDYRRVFDLACIDHRGTPEH 47 >ref|XP_004291271.1| PREDICTED: cation transport regulator-like protein 2-like [Fragaria vesca subsp. vesca] Length = 224 Score = 104 bits (259), Expect = 1e-20 Identities = 45/47 (95%), Positives = 46/47 (97%) Frame = -3 Query: 142 MVFWVFGYGSLVWNPGFEVDEKVIGFIKDYRRVFDLACIDHRGTPEH 2 MVFWVFGYGSLVWNPGFE DEKVIGFIKDY+RVFDLACIDHRGTPEH Sbjct: 1 MVFWVFGYGSLVWNPGFEYDEKVIGFIKDYKRVFDLACIDHRGTPEH 47 >gb|AFK43603.1| unknown [Lotus japonicus] Length = 224 Score = 104 bits (259), Expect = 1e-20 Identities = 45/47 (95%), Positives = 46/47 (97%) Frame = -3 Query: 142 MVFWVFGYGSLVWNPGFEVDEKVIGFIKDYRRVFDLACIDHRGTPEH 2 MVFWVFGYGSLVWNPGFE DEKVIG+IKDYRRVFDLACIDHRGTPEH Sbjct: 1 MVFWVFGYGSLVWNPGFEYDEKVIGYIKDYRRVFDLACIDHRGTPEH 47 >ref|XP_006483635.1| PREDICTED: cation transport regulator-like protein 2-like isoform X1 [Citrus sinensis] gi|568860247|ref|XP_006483636.1| PREDICTED: cation transport regulator-like protein 2-like isoform X2 [Citrus sinensis] gi|568860249|ref|XP_006483637.1| PREDICTED: cation transport regulator-like protein 2-like isoform X3 [Citrus sinensis] Length = 225 Score = 103 bits (256), Expect = 3e-20 Identities = 43/47 (91%), Positives = 46/47 (97%) Frame = -3 Query: 142 MVFWVFGYGSLVWNPGFEVDEKVIGFIKDYRRVFDLACIDHRGTPEH 2 MVFWVFGYGSLVWNPGFE DEK++GFIKDYRRVFDLACIDHRGTP+H Sbjct: 1 MVFWVFGYGSLVWNPGFEYDEKILGFIKDYRRVFDLACIDHRGTPQH 47 >ref|XP_007223927.1| hypothetical protein PRUPE_ppa011048mg [Prunus persica] gi|462420863|gb|EMJ25126.1| hypothetical protein PRUPE_ppa011048mg [Prunus persica] Length = 225 Score = 103 bits (256), Expect = 3e-20 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = -3 Query: 142 MVFWVFGYGSLVWNPGFEVDEKVIGFIKDYRRVFDLACIDHRGTPEH 2 MVFWVFGYGSLVWNPGFE DEKVIG+IKDYRRVFD+ACIDHRGTPEH Sbjct: 1 MVFWVFGYGSLVWNPGFEYDEKVIGYIKDYRRVFDVACIDHRGTPEH 47 >ref|XP_007011512.1| ChaC family protein-like [Theobroma cacao] gi|508781875|gb|EOY29131.1| ChaC family protein-like [Theobroma cacao] Length = 325 Score = 102 bits (255), Expect = 4e-20 Identities = 45/47 (95%), Positives = 46/47 (97%) Frame = -3 Query: 142 MVFWVFGYGSLVWNPGFEVDEKVIGFIKDYRRVFDLACIDHRGTPEH 2 MVFWVFGYGSLVWNPGFE DEKVIGFIKDYRRVFDLACIDHRGTPE+ Sbjct: 101 MVFWVFGYGSLVWNPGFEYDEKVIGFIKDYRRVFDLACIDHRGTPEN 147 >ref|XP_006382203.1| ChaC-like family protein [Populus trichocarpa] gi|550337358|gb|ERP60000.1| ChaC-like family protein [Populus trichocarpa] Length = 223 Score = 102 bits (254), Expect = 6e-20 Identities = 45/46 (97%), Positives = 45/46 (97%) Frame = -3 Query: 142 MVFWVFGYGSLVWNPGFEVDEKVIGFIKDYRRVFDLACIDHRGTPE 5 MVFWVFGYGSLVWNPGFE DEKVIGFIKDYRRVFDLACIDHRGTPE Sbjct: 1 MVFWVFGYGSLVWNPGFEYDEKVIGFIKDYRRVFDLACIDHRGTPE 46 >gb|ABK95363.1| unknown [Populus trichocarpa] Length = 223 Score = 102 bits (254), Expect = 6e-20 Identities = 45/46 (97%), Positives = 45/46 (97%) Frame = -3 Query: 142 MVFWVFGYGSLVWNPGFEVDEKVIGFIKDYRRVFDLACIDHRGTPE 5 MVFWVFGYGSLVWNPGFE DEKVIGFIKDYRRVFDLACIDHRGTPE Sbjct: 1 MVFWVFGYGSLVWNPGFEYDEKVIGFIKDYRRVFDLACIDHRGTPE 46 >ref|XP_006371827.1| ChaC-like family protein [Populus trichocarpa] gi|550318000|gb|ERP49624.1| ChaC-like family protein [Populus trichocarpa] Length = 223 Score = 102 bits (253), Expect = 7e-20 Identities = 44/46 (95%), Positives = 45/46 (97%) Frame = -3 Query: 142 MVFWVFGYGSLVWNPGFEVDEKVIGFIKDYRRVFDLACIDHRGTPE 5 MVFW+FGYGSLVWNPGFE DEKVIGFIKDYRRVFDLACIDHRGTPE Sbjct: 1 MVFWIFGYGSLVWNPGFEYDEKVIGFIKDYRRVFDLACIDHRGTPE 46 >gb|ABK96295.1| unknown [Populus trichocarpa x Populus deltoides] Length = 223 Score = 102 bits (253), Expect = 7e-20 Identities = 44/46 (95%), Positives = 45/46 (97%) Frame = -3 Query: 142 MVFWVFGYGSLVWNPGFEVDEKVIGFIKDYRRVFDLACIDHRGTPE 5 MVFW+FGYGSLVWNPGFE DEKVIGFIKDYRRVFDLACIDHRGTPE Sbjct: 1 MVFWIFGYGSLVWNPGFEYDEKVIGFIKDYRRVFDLACIDHRGTPE 46 >ref|XP_006357035.1| PREDICTED: cation transport regulator-like protein 2-like [Solanum tuberosum] Length = 227 Score = 101 bits (252), Expect = 9e-20 Identities = 42/47 (89%), Positives = 46/47 (97%) Frame = -3 Query: 142 MVFWVFGYGSLVWNPGFEVDEKVIGFIKDYRRVFDLACIDHRGTPEH 2 MVFW+FGYGSLVWNPGFE DEK+IG+IKDY+RVFDLACIDHRGTPEH Sbjct: 1 MVFWIFGYGSLVWNPGFEYDEKMIGYIKDYKRVFDLACIDHRGTPEH 47 >ref|XP_006450090.1| hypothetical protein CICLE_v10009681mg [Citrus clementina] gi|567916170|ref|XP_006450091.1| hypothetical protein CICLE_v10009681mg [Citrus clementina] gi|567916176|ref|XP_006450094.1| hypothetical protein CICLE_v10009681mg [Citrus clementina] gi|557553316|gb|ESR63330.1| hypothetical protein CICLE_v10009681mg [Citrus clementina] gi|557553317|gb|ESR63331.1| hypothetical protein CICLE_v10009681mg [Citrus clementina] gi|557553320|gb|ESR63334.1| hypothetical protein CICLE_v10009681mg [Citrus clementina] Length = 225 Score = 101 bits (252), Expect = 9e-20 Identities = 42/47 (89%), Positives = 46/47 (97%) Frame = -3 Query: 142 MVFWVFGYGSLVWNPGFEVDEKVIGFIKDYRRVFDLACIDHRGTPEH 2 MVFWVFGYGSLVWNPGF+ DEK++GFIKDYRRVFDLACIDHRGTP+H Sbjct: 1 MVFWVFGYGSLVWNPGFKYDEKILGFIKDYRRVFDLACIDHRGTPQH 47 >ref|XP_006450089.1| hypothetical protein CICLE_v10009681mg [Citrus clementina] gi|567916172|ref|XP_006450092.1| hypothetical protein CICLE_v10009681mg [Citrus clementina] gi|567916174|ref|XP_006450093.1| hypothetical protein CICLE_v10009681mg [Citrus clementina] gi|557553315|gb|ESR63329.1| hypothetical protein CICLE_v10009681mg [Citrus clementina] gi|557553318|gb|ESR63332.1| hypothetical protein CICLE_v10009681mg [Citrus clementina] gi|557553319|gb|ESR63333.1| hypothetical protein CICLE_v10009681mg [Citrus clementina] Length = 175 Score = 101 bits (252), Expect = 9e-20 Identities = 42/47 (89%), Positives = 46/47 (97%) Frame = -3 Query: 142 MVFWVFGYGSLVWNPGFEVDEKVIGFIKDYRRVFDLACIDHRGTPEH 2 MVFWVFGYGSLVWNPGF+ DEK++GFIKDYRRVFDLACIDHRGTP+H Sbjct: 1 MVFWVFGYGSLVWNPGFKYDEKILGFIKDYRRVFDLACIDHRGTPQH 47 >ref|XP_004244472.1| PREDICTED: cation transport regulator-like protein 2-like isoform 2 [Solanum lycopersicum] Length = 228 Score = 101 bits (252), Expect = 9e-20 Identities = 42/47 (89%), Positives = 46/47 (97%) Frame = -3 Query: 142 MVFWVFGYGSLVWNPGFEVDEKVIGFIKDYRRVFDLACIDHRGTPEH 2 MVFW+FGYGSLVWNPGFE DEK+IG+IKDY+RVFDLACIDHRGTPEH Sbjct: 1 MVFWIFGYGSLVWNPGFEYDEKLIGYIKDYKRVFDLACIDHRGTPEH 47 >ref|XP_004244471.1| PREDICTED: cation transport regulator-like protein 2-like isoform 1 [Solanum lycopersicum] Length = 243 Score = 101 bits (252), Expect = 9e-20 Identities = 42/47 (89%), Positives = 46/47 (97%) Frame = -3 Query: 142 MVFWVFGYGSLVWNPGFEVDEKVIGFIKDYRRVFDLACIDHRGTPEH 2 MVFW+FGYGSLVWNPGFE DEK+IG+IKDY+RVFDLACIDHRGTPEH Sbjct: 16 MVFWIFGYGSLVWNPGFEYDEKLIGYIKDYKRVFDLACIDHRGTPEH 62 >ref|NP_001275463.1| cation transport regulator-like protein 2-like [Solanum tuberosum] gi|82623379|gb|ABB87104.1| ChaC-like family protein-like [Solanum tuberosum] Length = 231 Score = 101 bits (252), Expect = 9e-20 Identities = 42/47 (89%), Positives = 46/47 (97%) Frame = -3 Query: 142 MVFWVFGYGSLVWNPGFEVDEKVIGFIKDYRRVFDLACIDHRGTPEH 2 MVFW+FGYGSLVWNPGFE DEK+IG+IKDY+RVFDLACIDHRGTPEH Sbjct: 1 MVFWIFGYGSLVWNPGFEYDEKMIGYIKDYKRVFDLACIDHRGTPEH 47 >gb|ABA46779.1| meloidogyne-induced giant cell protein-like protein [Solanum tuberosum] Length = 227 Score = 101 bits (252), Expect = 9e-20 Identities = 42/47 (89%), Positives = 46/47 (97%) Frame = -3 Query: 142 MVFWVFGYGSLVWNPGFEVDEKVIGFIKDYRRVFDLACIDHRGTPEH 2 MVFW+FGYGSLVWNPGFE DEK+IG+IKDY+RVFDLACIDHRGTPEH Sbjct: 1 MVFWIFGYGSLVWNPGFEYDEKMIGYIKDYKRVFDLACIDHRGTPEH 47 >ref|XP_004501211.1| PREDICTED: cation transport regulator-like protein 2-like [Cicer arietinum] Length = 224 Score = 101 bits (251), Expect = 1e-19 Identities = 43/47 (91%), Positives = 46/47 (97%) Frame = -3 Query: 142 MVFWVFGYGSLVWNPGFEVDEKVIGFIKDYRRVFDLACIDHRGTPEH 2 MVFWVFGYGSLVWNPGF+ DEK+IGFIKDYRRVFDLACIDHRGTPE+ Sbjct: 1 MVFWVFGYGSLVWNPGFDYDEKIIGFIKDYRRVFDLACIDHRGTPEN 47 >ref|XP_003522674.1| PREDICTED: cation transport regulator-like protein 2-like [Glycine max] Length = 224 Score = 101 bits (251), Expect = 1e-19 Identities = 43/47 (91%), Positives = 46/47 (97%) Frame = -3 Query: 142 MVFWVFGYGSLVWNPGFEVDEKVIGFIKDYRRVFDLACIDHRGTPEH 2 MVFWVFGYGSLVWNPGF+ DEK+IGFIKDYRRVFDLACIDHRGTPE+ Sbjct: 1 MVFWVFGYGSLVWNPGFDYDEKIIGFIKDYRRVFDLACIDHRGTPEN 47 >emb|CAD38520.1| putative cation transporter [Beta procumbens] Length = 222 Score = 100 bits (250), Expect = 2e-19 Identities = 41/47 (87%), Positives = 46/47 (97%) Frame = -3 Query: 142 MVFWVFGYGSLVWNPGFEVDEKVIGFIKDYRRVFDLACIDHRGTPEH 2 MVFW+FGYGSLVWNPGF+ DEKV+G+IKDY+RVFDLACIDHRGTPEH Sbjct: 1 MVFWIFGYGSLVWNPGFQYDEKVLGYIKDYKRVFDLACIDHRGTPEH 47