BLASTX nr result
ID: Mentha26_contig00018464
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00018464 (328 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006364809.1| PREDICTED: 39S ribosomal protein L24, mitoch... 72 8e-11 ref|XP_004245979.1| PREDICTED: 39S ribosomal protein L24, mitoch... 72 8e-11 gb|ACF72672.1| ribosomal protein L24 [Cucumis melo var. cantalupo] 70 3e-10 ref|XP_002524753.1| mitochondrial ribosomal protein L24, putativ... 70 4e-10 ref|XP_007050544.1| KOW domain-containing protein [Theobroma cac... 69 7e-10 gb|EYU37526.1| hypothetical protein MIMGU_mgv1a015391mg [Mimulus... 69 9e-10 ref|XP_004166518.1| PREDICTED: 50S ribosomal protein L24-like [C... 69 9e-10 ref|XP_002305718.1| hypothetical protein POPTR_0004s06120g [Popu... 67 2e-09 gb|EXB22119.1| 50S ribosomal protein L24 [Morus notabilis] 67 3e-09 ref|XP_007161244.1| hypothetical protein PHAVU_001G054100g [Phas... 67 3e-09 ref|XP_007161238.1| hypothetical protein PHAVU_001G053600g [Phas... 67 3e-09 ref|NP_001238714.1| uncharacterized protein LOC100305917 [Glycin... 67 3e-09 ref|NP_001236419.1| uncharacterized protein LOC100499816 [Glycin... 67 3e-09 ref|XP_002532971.1| mitochondrial ribosomal protein L24, putativ... 66 4e-09 ref|XP_003632319.1| PREDICTED: 39S ribosomal protein L24, mitoch... 66 4e-09 ref|XP_007225976.1| hypothetical protein PRUPE_ppa012657mg [Prun... 65 8e-09 ref|XP_006444034.1| hypothetical protein CICLE_v10022626mg [Citr... 65 1e-08 ref|XP_004290618.1| PREDICTED: 50S ribosomal protein L24-like [F... 64 2e-08 gb|AFK48729.1| unknown [Medicago truncatula] 64 2e-08 gb|AFK34367.1| unknown [Lotus japonicus] 64 2e-08 >ref|XP_006364809.1| PREDICTED: 39S ribosomal protein L24, mitochondrial-like [Solanum tuberosum] Length = 158 Score = 72.0 bits (175), Expect = 8e-11 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = +2 Query: 2 MRTTPRPTVVGPKDTPMDVVLERTYDPTTGKGMPDL 109 +RTTPRPTV GPKDTPM+VV+ERTYDP TGKGMPDL Sbjct: 123 IRTTPRPTVAGPKDTPMEVVMERTYDPKTGKGMPDL 158 >ref|XP_004245979.1| PREDICTED: 39S ribosomal protein L24, mitochondrial-like [Solanum lycopersicum] gi|565397787|ref|XP_006364466.1| PREDICTED: 39S ribosomal protein L24, mitochondrial-like isoform X1 [Solanum tuberosum] gi|565397789|ref|XP_006364467.1| PREDICTED: 39S ribosomal protein L24, mitochondrial-like isoform X2 [Solanum tuberosum] Length = 159 Score = 72.0 bits (175), Expect = 8e-11 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = +2 Query: 2 MRTTPRPTVVGPKDTPMDVVLERTYDPTTGKGMPDL 109 +RTTPRPTV GPKDTPM+VV+ERTYDP TGKGMPDL Sbjct: 124 IRTTPRPTVAGPKDTPMEVVMERTYDPKTGKGMPDL 159 >gb|ACF72672.1| ribosomal protein L24 [Cucumis melo var. cantalupo] Length = 159 Score = 70.1 bits (170), Expect = 3e-10 Identities = 30/36 (83%), Positives = 34/36 (94%) Frame = +2 Query: 2 MRTTPRPTVVGPKDTPMDVVLERTYDPTTGKGMPDL 109 +RT+PRPTV GPKDTPMDVVLE+TYDP TGKGMP+L Sbjct: 124 IRTSPRPTVAGPKDTPMDVVLEKTYDPKTGKGMPEL 159 >ref|XP_002524753.1| mitochondrial ribosomal protein L24, putative [Ricinus communis] gi|223535937|gb|EEF37596.1| mitochondrial ribosomal protein L24, putative [Ricinus communis] Length = 159 Score = 69.7 bits (169), Expect = 4e-10 Identities = 29/36 (80%), Positives = 34/36 (94%) Frame = +2 Query: 2 MRTTPRPTVVGPKDTPMDVVLERTYDPTTGKGMPDL 109 MRTTPRP++ GPKDTPM++VLERTYDP TG+GMPDL Sbjct: 124 MRTTPRPSIAGPKDTPMNLVLERTYDPKTGRGMPDL 159 >ref|XP_007050544.1| KOW domain-containing protein [Theobroma cacao] gi|508702805|gb|EOX94701.1| KOW domain-containing protein [Theobroma cacao] Length = 159 Score = 68.9 bits (167), Expect = 7e-10 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = +2 Query: 2 MRTTPRPTVVGPKDTPMDVVLERTYDPTTGKGMPDL 109 +RTTPRPTV GPKDTPMD+VLE+TYD TGKGMPDL Sbjct: 124 IRTTPRPTVAGPKDTPMDLVLEKTYDSKTGKGMPDL 159 >gb|EYU37526.1| hypothetical protein MIMGU_mgv1a015391mg [Mimulus guttatus] Length = 159 Score = 68.6 bits (166), Expect = 9e-10 Identities = 29/36 (80%), Positives = 34/36 (94%) Frame = +2 Query: 2 MRTTPRPTVVGPKDTPMDVVLERTYDPTTGKGMPDL 109 +R+TPRPT+VGPKDTPMD+VLE+TYD TGKGMPDL Sbjct: 124 IRSTPRPTIVGPKDTPMDLVLEKTYDAQTGKGMPDL 159 >ref|XP_004166518.1| PREDICTED: 50S ribosomal protein L24-like [Cucumis sativus] Length = 159 Score = 68.6 bits (166), Expect = 9e-10 Identities = 29/36 (80%), Positives = 34/36 (94%) Frame = +2 Query: 2 MRTTPRPTVVGPKDTPMDVVLERTYDPTTGKGMPDL 109 +R++PRPTV GPKDTPMDVVLE+TYDP TGKGMP+L Sbjct: 124 IRSSPRPTVAGPKDTPMDVVLEKTYDPKTGKGMPEL 159 >ref|XP_002305718.1| hypothetical protein POPTR_0004s06120g [Populus trichocarpa] gi|222848682|gb|EEE86229.1| hypothetical protein POPTR_0004s06120g [Populus trichocarpa] Length = 159 Score = 67.4 bits (163), Expect = 2e-09 Identities = 29/36 (80%), Positives = 33/36 (91%) Frame = +2 Query: 2 MRTTPRPTVVGPKDTPMDVVLERTYDPTTGKGMPDL 109 +RTTPRPTV GPKDTPMD+VL++TYD TGKGMPDL Sbjct: 124 IRTTPRPTVAGPKDTPMDLVLKKTYDAKTGKGMPDL 159 >gb|EXB22119.1| 50S ribosomal protein L24 [Morus notabilis] Length = 159 Score = 67.0 bits (162), Expect = 3e-09 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = +2 Query: 2 MRTTPRPTVVGPKDTPMDVVLERTYDPTTGKGMPDL 109 +RTTPRPTV GPKDTPMDVVLE+TYD TG GMPDL Sbjct: 124 IRTTPRPTVAGPKDTPMDVVLEKTYDVKTGLGMPDL 159 >ref|XP_007161244.1| hypothetical protein PHAVU_001G054100g [Phaseolus vulgaris] gi|561034708|gb|ESW33238.1| hypothetical protein PHAVU_001G054100g [Phaseolus vulgaris] Length = 159 Score = 66.6 bits (161), Expect = 3e-09 Identities = 28/36 (77%), Positives = 34/36 (94%) Frame = +2 Query: 2 MRTTPRPTVVGPKDTPMDVVLERTYDPTTGKGMPDL 109 +RTTPRPTV+GPKDTPMD+VLE+TYD TG+GMP+L Sbjct: 124 IRTTPRPTVLGPKDTPMDLVLEKTYDAKTGRGMPEL 159 >ref|XP_007161238.1| hypothetical protein PHAVU_001G053600g [Phaseolus vulgaris] gi|561034702|gb|ESW33232.1| hypothetical protein PHAVU_001G053600g [Phaseolus vulgaris] Length = 159 Score = 66.6 bits (161), Expect = 3e-09 Identities = 28/36 (77%), Positives = 34/36 (94%) Frame = +2 Query: 2 MRTTPRPTVVGPKDTPMDVVLERTYDPTTGKGMPDL 109 +RTTPRPTV+GPKDTPMD+VLE+TYD TG+GMP+L Sbjct: 124 IRTTPRPTVLGPKDTPMDLVLEKTYDAKTGRGMPEL 159 >ref|NP_001238714.1| uncharacterized protein LOC100305917 [Glycine max] gi|255626969|gb|ACU13829.1| unknown [Glycine max] Length = 159 Score = 66.6 bits (161), Expect = 3e-09 Identities = 28/36 (77%), Positives = 34/36 (94%) Frame = +2 Query: 2 MRTTPRPTVVGPKDTPMDVVLERTYDPTTGKGMPDL 109 +RTTPRPTV+GPKDTPMD+VLE+TYD TG+GMP+L Sbjct: 124 IRTTPRPTVLGPKDTPMDLVLEKTYDAKTGRGMPEL 159 >ref|NP_001236419.1| uncharacterized protein LOC100499816 [Glycine max] gi|255626857|gb|ACU13773.1| unknown [Glycine max] Length = 159 Score = 66.6 bits (161), Expect = 3e-09 Identities = 28/36 (77%), Positives = 34/36 (94%) Frame = +2 Query: 2 MRTTPRPTVVGPKDTPMDVVLERTYDPTTGKGMPDL 109 +RTTPRPTV+GPKDTPMD+VLE+TYD TG+GMP+L Sbjct: 124 IRTTPRPTVLGPKDTPMDLVLEKTYDAKTGRGMPEL 159 >ref|XP_002532971.1| mitochondrial ribosomal protein L24, putative [Ricinus communis] gi|223527249|gb|EEF29408.1| mitochondrial ribosomal protein L24, putative [Ricinus communis] Length = 159 Score = 66.2 bits (160), Expect = 4e-09 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = +2 Query: 2 MRTTPRPTVVGPKDTPMDVVLERTYDPTTGKGMPDL 109 +RTTPRPT GPKDTP+D+VLERTYD TGKGMPDL Sbjct: 124 IRTTPRPTEAGPKDTPIDLVLERTYDAKTGKGMPDL 159 >ref|XP_003632319.1| PREDICTED: 39S ribosomal protein L24, mitochondrial-like [Vitis vinifera] gi|296085225|emb|CBI28720.3| unnamed protein product [Vitis vinifera] Length = 159 Score = 66.2 bits (160), Expect = 4e-09 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = +2 Query: 2 MRTTPRPTVVGPKDTPMDVVLERTYDPTTGKGMPDL 109 +RTTPRPTV GPKDTPMD+VLE+TYD TGKGMP L Sbjct: 124 IRTTPRPTVAGPKDTPMDLVLEKTYDAKTGKGMPGL 159 >ref|XP_007225976.1| hypothetical protein PRUPE_ppa012657mg [Prunus persica] gi|462422912|gb|EMJ27175.1| hypothetical protein PRUPE_ppa012657mg [Prunus persica] Length = 159 Score = 65.5 bits (158), Expect = 8e-09 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = +2 Query: 2 MRTTPRPTVVGPKDTPMDVVLERTYDPTTGKGMPDL 109 +RTT RPTV GPKDTPMDVVLE+TYD TGKGMP+L Sbjct: 124 IRTTSRPTVAGPKDTPMDVVLEKTYDAKTGKGMPEL 159 >ref|XP_006444034.1| hypothetical protein CICLE_v10022626mg [Citrus clementina] gi|568852040|ref|XP_006479689.1| PREDICTED: 39S ribosomal protein L24, mitochondrial-like isoform X1 [Citrus sinensis] gi|568852042|ref|XP_006479690.1| PREDICTED: 39S ribosomal protein L24, mitochondrial-like isoform X2 [Citrus sinensis] gi|557546296|gb|ESR57274.1| hypothetical protein CICLE_v10022626mg [Citrus clementina] Length = 159 Score = 65.1 bits (157), Expect = 1e-08 Identities = 27/36 (75%), Positives = 33/36 (91%) Frame = +2 Query: 2 MRTTPRPTVVGPKDTPMDVVLERTYDPTTGKGMPDL 109 +RTTPRPTV GPKDTP+D+V+E+TYD +GKGMPDL Sbjct: 124 IRTTPRPTVAGPKDTPVDLVMEKTYDAKSGKGMPDL 159 >ref|XP_004290618.1| PREDICTED: 50S ribosomal protein L24-like [Fragaria vesca subsp. vesca] Length = 159 Score = 64.3 bits (155), Expect = 2e-08 Identities = 27/36 (75%), Positives = 33/36 (91%) Frame = +2 Query: 2 MRTTPRPTVVGPKDTPMDVVLERTYDPTTGKGMPDL 109 +RTTPRPTV GPKDTP+++VLE+TYD TGKGMP+L Sbjct: 124 IRTTPRPTVAGPKDTPLNLVLEKTYDAKTGKGMPEL 159 >gb|AFK48729.1| unknown [Medicago truncatula] Length = 159 Score = 63.9 bits (154), Expect = 2e-08 Identities = 26/36 (72%), Positives = 33/36 (91%) Frame = +2 Query: 2 MRTTPRPTVVGPKDTPMDVVLERTYDPTTGKGMPDL 109 +RTTPRP+V GPKDTPM++VLE+TYD TG+GMP+L Sbjct: 124 IRTTPRPSVAGPKDTPMEIVLEKTYDSKTGRGMPEL 159 >gb|AFK34367.1| unknown [Lotus japonicus] Length = 159 Score = 63.9 bits (154), Expect = 2e-08 Identities = 26/36 (72%), Positives = 34/36 (94%) Frame = +2 Query: 2 MRTTPRPTVVGPKDTPMDVVLERTYDPTTGKGMPDL 109 +RTTPRP+V+GP+DTPMD+VLE+TYD TG+GMP+L Sbjct: 124 IRTTPRPSVLGPRDTPMDLVLEKTYDAKTGRGMPEL 159