BLASTX nr result
ID: Mentha26_contig00018441
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00018441 (337 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006362874.1| PREDICTED: NAC domain-containing protein 90-... 56 6e-06 >ref|XP_006362874.1| PREDICTED: NAC domain-containing protein 90-like [Solanum tuberosum] Length = 261 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/41 (60%), Positives = 30/41 (73%) Frame = +2 Query: 5 TTSIPMLRHDMCVCRVYVVSGSLRAFDRRPTHVEEGEPSSA 127 T SIP LRH+M +CR+YV+SGS RAFDRRP EPS + Sbjct: 144 TISIPKLRHEMSLCRIYVISGSFRAFDRRPIATITREPSKS 184