BLASTX nr result
ID: Mentha26_contig00018283
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00018283 (434 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006445317.1| hypothetical protein CICLE_v10020384mg [Citr... 64 3e-08 ref|XP_004306954.1| PREDICTED: phosphatidate cytidylyltransferas... 64 3e-08 ref|XP_007218092.1| hypothetical protein PRUPE_ppa006483mg [Prun... 62 6e-08 ref|XP_002511659.1| Phosphatidate cytidylyltransferase, putative... 62 6e-08 ref|XP_002281170.2| PREDICTED: phosphatidate cytidylyltransferas... 62 8e-08 emb|CBI38909.3| unnamed protein product [Vitis vinifera] 62 8e-08 gb|EPS74457.1| phosphatidate cytidylyltransferase, partial [Genl... 62 1e-07 gb|EYU31955.1| hypothetical protein MIMGU_mgv1a007444mg [Mimulus... 61 1e-07 ref|XP_004500344.1| PREDICTED: phosphatidate cytidylyltransferas... 60 2e-07 gb|EXB37094.1| Phosphatidate cytidylyltransferase [Morus notabilis] 60 3e-07 ref|XP_006375285.1| hypothetical protein POPTR_0014s05900g [Popu... 59 5e-07 ref|XP_006347895.1| PREDICTED: uncharacterized protein LOC102578... 59 7e-07 ref|XP_004229789.1| PREDICTED: phosphatidate cytidylyltransferas... 59 7e-07 ref|XP_003538330.1| PREDICTED: uncharacterized protein LOC100814... 59 9e-07 ref|XP_004163756.1| PREDICTED: phosphatidate cytidylyltransferas... 57 3e-06 ref|XP_004140488.1| PREDICTED: phosphatidate cytidylyltransferas... 57 3e-06 ref|NP_566035.2| cytidinediphosphate diacylglycerol synthase 4 [... 57 3e-06 ref|NP_973692.1| cytidinediphosphate diacylglycerol synthase 4 [... 57 3e-06 ref|XP_003551170.1| PREDICTED: uncharacterized protein LOC100809... 57 3e-06 gb|AAK92713.1| putative phosphatidate cytidylyltransferase [Arab... 57 3e-06 >ref|XP_006445317.1| hypothetical protein CICLE_v10020384mg [Citrus clementina] gi|568875565|ref|XP_006490863.1| PREDICTED: uncharacterized protein LOC102610652 [Citrus sinensis] gi|557547579|gb|ESR58557.1| hypothetical protein CICLE_v10020384mg [Citrus clementina] Length = 410 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -3 Query: 432 GGILDRVDSYIFTGALAYSFVKTFLPLYGI 343 GGILDRVDSYIFTGALAYSFVKTFLPLYG+ Sbjct: 381 GGILDRVDSYIFTGALAYSFVKTFLPLYGV 410 >ref|XP_004306954.1| PREDICTED: phosphatidate cytidylyltransferase-like [Fragaria vesca subsp. vesca] Length = 413 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -3 Query: 432 GGILDRVDSYIFTGALAYSFVKTFLPLYGI 343 GGILDRVDSYIFTGALAYSFVKTFLPLYG+ Sbjct: 384 GGILDRVDSYIFTGALAYSFVKTFLPLYGV 413 >ref|XP_007218092.1| hypothetical protein PRUPE_ppa006483mg [Prunus persica] gi|462414554|gb|EMJ19291.1| hypothetical protein PRUPE_ppa006483mg [Prunus persica] Length = 409 Score = 62.4 bits (150), Expect = 6e-08 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -3 Query: 432 GGILDRVDSYIFTGALAYSFVKTFLPLYGI 343 GGILDRVDSY+FTGALAYSFVKTFLPLYG+ Sbjct: 380 GGILDRVDSYMFTGALAYSFVKTFLPLYGV 409 >ref|XP_002511659.1| Phosphatidate cytidylyltransferase, putative [Ricinus communis] gi|223548839|gb|EEF50328.1| Phosphatidate cytidylyltransferase, putative [Ricinus communis] Length = 404 Score = 62.4 bits (150), Expect = 6e-08 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -3 Query: 432 GGILDRVDSYIFTGALAYSFVKTFLPLYGI 343 GGILDRVDSY+FTGALAYSFVKTFLPLYG+ Sbjct: 375 GGILDRVDSYMFTGALAYSFVKTFLPLYGV 404 >ref|XP_002281170.2| PREDICTED: phosphatidate cytidylyltransferase [Vitis vinifera] Length = 402 Score = 62.0 bits (149), Expect = 8e-08 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 432 GGILDRVDSYIFTGALAYSFVKTFLPLYGI 343 GGILDR DSYIFTGALAYSFVKTFLPLYG+ Sbjct: 373 GGILDRADSYIFTGALAYSFVKTFLPLYGV 402 >emb|CBI38909.3| unnamed protein product [Vitis vinifera] Length = 397 Score = 62.0 bits (149), Expect = 8e-08 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 432 GGILDRVDSYIFTGALAYSFVKTFLPLYGI 343 GGILDR DSYIFTGALAYSFVKTFLPLYG+ Sbjct: 368 GGILDRADSYIFTGALAYSFVKTFLPLYGV 397 >gb|EPS74457.1| phosphatidate cytidylyltransferase, partial [Genlisea aurea] Length = 308 Score = 61.6 bits (148), Expect = 1e-07 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -3 Query: 432 GGILDRVDSYIFTGALAYSFVKTFLPLYGI 343 GG+LDR DSYIFTGALAYSFVKTFLPLYG+ Sbjct: 279 GGVLDRTDSYIFTGALAYSFVKTFLPLYGV 308 >gb|EYU31955.1| hypothetical protein MIMGU_mgv1a007444mg [Mimulus guttatus] Length = 407 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 432 GGILDRVDSYIFTGALAYSFVKTFLPLYGI 343 GGILDRVDSYIFTGALAYSFVK FLPLYG+ Sbjct: 378 GGILDRVDSYIFTGALAYSFVKKFLPLYGV 407 >ref|XP_004500344.1| PREDICTED: phosphatidate cytidylyltransferase-like [Cicer arietinum] Length = 383 Score = 60.5 bits (145), Expect = 2e-07 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = -3 Query: 432 GGILDRVDSYIFTGALAYSFVKTFLPLYGI 343 GG+LDR DSY+FTGALAYSFVKTF+PLYG+ Sbjct: 354 GGVLDRADSYVFTGALAYSFVKTFMPLYGV 383 >gb|EXB37094.1| Phosphatidate cytidylyltransferase [Morus notabilis] Length = 417 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -3 Query: 432 GGILDRVDSYIFTGALAYSFVKTFLPLYGI 343 GGILDRVDSY+FTGALAYSFVK FLPLYG+ Sbjct: 388 GGILDRVDSYMFTGALAYSFVKIFLPLYGV 417 >ref|XP_006375285.1| hypothetical protein POPTR_0014s05900g [Populus trichocarpa] gi|550323604|gb|ERP53082.1| hypothetical protein POPTR_0014s05900g [Populus trichocarpa] Length = 405 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -3 Query: 432 GGILDRVDSYIFTGALAYSFVKTFLPLYGI 343 GGILDR DSYIFTGALAYSFVK FLPLYG+ Sbjct: 376 GGILDRSDSYIFTGALAYSFVKAFLPLYGV 405 >ref|XP_006347895.1| PREDICTED: uncharacterized protein LOC102578208 isoform X1 [Solanum tuberosum] Length = 428 Score = 58.9 bits (141), Expect = 7e-07 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -3 Query: 432 GGILDRVDSYIFTGALAYSFVKTFLPLYGI 343 GGILDRVDSYIFTGALAYSFVK LPLYG+ Sbjct: 399 GGILDRVDSYIFTGALAYSFVKMLLPLYGV 428 >ref|XP_004229789.1| PREDICTED: phosphatidate cytidylyltransferase-like [Solanum lycopersicum] Length = 201 Score = 58.9 bits (141), Expect = 7e-07 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -3 Query: 432 GGILDRVDSYIFTGALAYSFVKTFLPLYGI 343 GGILDRVDSYIFTGALAYSFVK LPLYG+ Sbjct: 172 GGILDRVDSYIFTGALAYSFVKMLLPLYGV 201 >ref|XP_003538330.1| PREDICTED: uncharacterized protein LOC100814316 isoform X1 [Glycine max] Length = 399 Score = 58.5 bits (140), Expect = 9e-07 Identities = 24/30 (80%), Positives = 29/30 (96%) Frame = -3 Query: 432 GGILDRVDSYIFTGALAYSFVKTFLPLYGI 343 GG+LDR DSY+FTGALAY+FVKTFLP+YG+ Sbjct: 370 GGVLDRADSYLFTGALAYNFVKTFLPVYGV 399 >ref|XP_004163756.1| PREDICTED: phosphatidate cytidylyltransferase-like [Cucumis sativus] Length = 406 Score = 57.0 bits (136), Expect = 3e-06 Identities = 23/30 (76%), Positives = 29/30 (96%) Frame = -3 Query: 432 GGILDRVDSYIFTGALAYSFVKTFLPLYGI 343 GG+LDRVDSYIF+GALAYS++K F+PLYG+ Sbjct: 377 GGLLDRVDSYIFSGALAYSYIKAFMPLYGV 406 >ref|XP_004140488.1| PREDICTED: phosphatidate cytidylyltransferase-like [Cucumis sativus] Length = 406 Score = 57.0 bits (136), Expect = 3e-06 Identities = 23/30 (76%), Positives = 29/30 (96%) Frame = -3 Query: 432 GGILDRVDSYIFTGALAYSFVKTFLPLYGI 343 GG+LDRVDSYIF+GALAYS++K F+PLYG+ Sbjct: 377 GGLLDRVDSYIFSGALAYSYIKAFMPLYGV 406 >ref|NP_566035.2| cytidinediphosphate diacylglycerol synthase 4 [Arabidopsis thaliana] gi|330255421|gb|AEC10515.1| cytidinediphosphate diacylglycerol synthase 4 [Arabidopsis thaliana] Length = 430 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -3 Query: 432 GGILDRVDSYIFTGALAYSFVKTFLPLYGI 343 GGILDRVDSYIFTGALAYSF+KT L LYG+ Sbjct: 401 GGILDRVDSYIFTGALAYSFIKTSLKLYGV 430 >ref|NP_973692.1| cytidinediphosphate diacylglycerol synthase 4 [Arabidopsis thaliana] gi|111074402|gb|ABH04574.1| At2g45150 [Arabidopsis thaliana] gi|222423214|dbj|BAH19584.1| AT2G45150 [Arabidopsis thaliana] gi|330255422|gb|AEC10516.1| cytidinediphosphate diacylglycerol synthase 4 [Arabidopsis thaliana] Length = 382 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -3 Query: 432 GGILDRVDSYIFTGALAYSFVKTFLPLYGI 343 GGILDRVDSYIFTGALAYSF+KT L LYG+ Sbjct: 353 GGILDRVDSYIFTGALAYSFIKTSLKLYGV 382 >ref|XP_003551170.1| PREDICTED: uncharacterized protein LOC100809100 isoform X1 [Glycine max] gi|571543378|ref|XP_006602067.1| PREDICTED: uncharacterized protein LOC100809100 isoform X2 [Glycine max] Length = 396 Score = 57.0 bits (136), Expect = 3e-06 Identities = 23/30 (76%), Positives = 28/30 (93%) Frame = -3 Query: 432 GGILDRVDSYIFTGALAYSFVKTFLPLYGI 343 GG+LDR DSY+FTGALAY+F+KT LPLYG+ Sbjct: 367 GGVLDRADSYVFTGALAYNFIKTVLPLYGV 396 >gb|AAK92713.1| putative phosphatidate cytidylyltransferase [Arabidopsis thaliana] Length = 391 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -3 Query: 432 GGILDRVDSYIFTGALAYSFVKTFLPLYGI 343 GGILDRVDSYIFTGALAYSF+KT L LYG+ Sbjct: 362 GGILDRVDSYIFTGALAYSFIKTSLKLYGV 391