BLASTX nr result
ID: Mentha26_contig00018238
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00018238 (463 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006360984.1| PREDICTED: K(+) efflux antiporter 4-like [So... 94 3e-17 gb|EYU20363.1| hypothetical protein MIMGU_mgv1a003437mg [Mimulus... 92 8e-17 ref|XP_004245107.1| PREDICTED: K(+) efflux antiporter 4-like [So... 92 8e-17 ref|XP_003589023.1| Glutathione-regulated potassium-efflux syste... 82 6e-14 ref|XP_003549355.2| PREDICTED: K(+) efflux antiporter 6-like iso... 80 2e-13 ref|XP_004498909.1| PREDICTED: K(+) efflux antiporter 6-like [Ci... 77 2e-12 ref|XP_003544527.1| PREDICTED: K(+) efflux antiporter 6-like [Gl... 77 3e-12 gb|EXB66875.1| K(+) efflux antiporter 6 [Morus notabilis] 75 7e-12 ref|XP_006475944.1| PREDICTED: LOW QUALITY PROTEIN: K(+) efflux ... 75 9e-12 ref|XP_002516454.1| potassium:hydrogen antiporter, putative [Ric... 74 3e-11 ref|XP_007160996.1| hypothetical protein PHAVU_001G034400g [Phas... 73 4e-11 ref|XP_007012264.1| K+ efflux antiporter 4 [Theobroma cacao] gi|... 72 6e-11 gb|EPS73308.1| hypothetical protein M569_01441 [Genlisea aurea] 72 8e-11 ref|XP_007225682.1| hypothetical protein PRUPE_ppa003277mg [Prun... 71 2e-10 ref|XP_002308566.2| K+ efflux antiporter family protein [Populus... 70 2e-10 ref|XP_004291032.1| PREDICTED: K(+) efflux antiporter 6-like [Fr... 69 7e-10 ref|XP_006451437.1| hypothetical protein CICLE_v10007842mg [Citr... 67 2e-09 ref|XP_006451436.1| hypothetical protein CICLE_v10007842mg [Citr... 67 2e-09 ref|XP_006408878.1| hypothetical protein EUTSA_v10001937mg [Eutr... 66 4e-09 ref|XP_007012871.1| K+ efflux antiporter 4 isoform 3 [Theobroma ... 66 4e-09 >ref|XP_006360984.1| PREDICTED: K(+) efflux antiporter 4-like [Solanum tuberosum] Length = 599 Score = 93.6 bits (231), Expect = 3e-17 Identities = 44/55 (80%), Positives = 48/55 (87%) Frame = +3 Query: 51 PLLFKLIPAVVHLGILLRWFTPETQIELGLKVDNLRSDSAKQRIALISKDLIHEG 215 PLLFKLIPAVVHLG+LLRWF P++ E G K DN RSDSAKQRIAL+SKDLIHEG Sbjct: 545 PLLFKLIPAVVHLGVLLRWFPPDSPSEFGFKSDNFRSDSAKQRIALVSKDLIHEG 599 >gb|EYU20363.1| hypothetical protein MIMGU_mgv1a003437mg [Mimulus guttatus] Length = 585 Score = 92.0 bits (227), Expect = 8e-17 Identities = 47/56 (83%), Positives = 51/56 (91%), Gaps = 1/56 (1%) Frame = +3 Query: 51 PLLFKLIPAVVHLGILLRWFTPETQIELGLKVDNLRSDSAKQRIALISKD-LIHEG 215 PLLFKLIPAVVHLG+LLRWF+PE+Q ELG K D LR+DSAKQRIALISKD LIHEG Sbjct: 530 PLLFKLIPAVVHLGVLLRWFSPESQTELGFKGDVLRTDSAKQRIALISKDLLIHEG 585 >ref|XP_004245107.1| PREDICTED: K(+) efflux antiporter 4-like [Solanum lycopersicum] Length = 599 Score = 92.0 bits (227), Expect = 8e-17 Identities = 43/55 (78%), Positives = 47/55 (85%) Frame = +3 Query: 51 PLLFKLIPAVVHLGILLRWFTPETQIELGLKVDNLRSDSAKQRIALISKDLIHEG 215 PLLFKLIP VVHLG+LLRWF P++ E G K DN RSDSAKQRIAL+SKDLIHEG Sbjct: 545 PLLFKLIPGVVHLGVLLRWFPPDSPSEFGFKSDNFRSDSAKQRIALVSKDLIHEG 599 >ref|XP_003589023.1| Glutathione-regulated potassium-efflux system protein kefB [Medicago truncatula] gi|355478071|gb|AES59274.1| Glutathione-regulated potassium-efflux system protein kefB [Medicago truncatula] Length = 655 Score = 82.4 bits (202), Expect = 6e-14 Identities = 36/50 (72%), Positives = 45/50 (90%) Frame = +3 Query: 51 PLLFKLIPAVVHLGILLRWFTPETQIELGLKVDNLRSDSAKQRIALISKD 200 PLLFKLIPAVVHLG+LLRWF+P++ +E+G KVDNLRSDS KQR+ LI ++ Sbjct: 602 PLLFKLIPAVVHLGVLLRWFSPDSAVEIGYKVDNLRSDSGKQRVVLIDQE 651 >ref|XP_003549355.2| PREDICTED: K(+) efflux antiporter 6-like isoform X1 [Glycine max] Length = 593 Score = 80.5 bits (197), Expect = 2e-13 Identities = 35/50 (70%), Positives = 45/50 (90%) Frame = +3 Query: 51 PLLFKLIPAVVHLGILLRWFTPETQIELGLKVDNLRSDSAKQRIALISKD 200 PLLFKLIPAVVHLG+LLRWF+P++ +E+G K+DNLRSDS KQRI L+ ++ Sbjct: 540 PLLFKLIPAVVHLGVLLRWFSPDSSVEIGYKLDNLRSDSGKQRIILMDQE 589 >ref|XP_004498909.1| PREDICTED: K(+) efflux antiporter 6-like [Cicer arietinum] Length = 587 Score = 77.0 bits (188), Expect = 2e-12 Identities = 33/50 (66%), Positives = 43/50 (86%) Frame = +3 Query: 51 PLLFKLIPAVVHLGILLRWFTPETQIELGLKVDNLRSDSAKQRIALISKD 200 PLLFKL PAVVHLG+LLRWF+P++ +E+G K+DNLRSDS K RI L+ ++ Sbjct: 534 PLLFKLTPAVVHLGVLLRWFSPDSSVEIGYKIDNLRSDSGKLRIVLMDQE 583 >ref|XP_003544527.1| PREDICTED: K(+) efflux antiporter 6-like [Glycine max] Length = 598 Score = 76.6 bits (187), Expect = 3e-12 Identities = 34/50 (68%), Positives = 44/50 (88%) Frame = +3 Query: 51 PLLFKLIPAVVHLGILLRWFTPETQIELGLKVDNLRSDSAKQRIALISKD 200 PLLFKLIPAVVHLG+LLRWF+ ++ +E+G K+DNLRSDS KQRI L+ ++ Sbjct: 545 PLLFKLIPAVVHLGVLLRWFSTDSSMEIGYKLDNLRSDSGKQRIILMDQE 594 >gb|EXB66875.1| K(+) efflux antiporter 6 [Morus notabilis] Length = 1176 Score = 75.5 bits (184), Expect = 7e-12 Identities = 34/47 (72%), Positives = 41/47 (87%) Frame = +3 Query: 51 PLLFKLIPAVVHLGILLRWFTPETQIELGLKVDNLRSDSAKQRIALI 191 PLLFKLIPAVVHLG+LLRWF P++ +E+G K +NLRSDS KQRI L+ Sbjct: 1123 PLLFKLIPAVVHLGVLLRWFPPDSSVEVGFKGENLRSDSGKQRIILM 1169 >ref|XP_006475944.1| PREDICTED: LOW QUALITY PROTEIN: K(+) efflux antiporter 6-like [Citrus sinensis] Length = 586 Score = 75.1 bits (183), Expect = 9e-12 Identities = 35/47 (74%), Positives = 40/47 (85%) Frame = +3 Query: 51 PLLFKLIPAVVHLGILLRWFTPETQIELGLKVDNLRSDSAKQRIALI 191 PLLFKLIP VVHLG+LLRWF+P++ IE G K DNLRS+S KQRI LI Sbjct: 529 PLLFKLIPGVVHLGVLLRWFSPDSSIENGFKGDNLRSESGKQRITLI 575 >ref|XP_002516454.1| potassium:hydrogen antiporter, putative [Ricinus communis] gi|223544274|gb|EEF45795.1| potassium:hydrogen antiporter, putative [Ricinus communis] Length = 494 Score = 73.6 bits (179), Expect = 3e-11 Identities = 32/47 (68%), Positives = 39/47 (82%) Frame = +3 Query: 51 PLLFKLIPAVVHLGILLRWFTPETQIELGLKVDNLRSDSAKQRIALI 191 PLLFKLIPAV HLG+LLRWF P++ +E+G K D+ RSDS KQRI L+ Sbjct: 441 PLLFKLIPAVAHLGVLLRWFPPDSSVEIGFKGDSFRSDSGKQRITLV 487 >ref|XP_007160996.1| hypothetical protein PHAVU_001G034400g [Phaseolus vulgaris] gi|561034460|gb|ESW32990.1| hypothetical protein PHAVU_001G034400g [Phaseolus vulgaris] Length = 591 Score = 73.2 bits (178), Expect = 4e-11 Identities = 33/51 (64%), Positives = 45/51 (88%), Gaps = 1/51 (1%) Frame = +3 Query: 51 PLLFKLIPAVVHLGILLRWFTPETQIELGL-KVDNLRSDSAKQRIALISKD 200 PLLFKLIPAVVHLG+LLRWF+P++ +E+G KVD+LRS+S KQR+ L+ ++ Sbjct: 537 PLLFKLIPAVVHLGVLLRWFSPDSSVEIGYSKVDSLRSESGKQRVILMDQE 587 >ref|XP_007012264.1| K+ efflux antiporter 4 [Theobroma cacao] gi|508782627|gb|EOY29883.1| K+ efflux antiporter 4 [Theobroma cacao] Length = 599 Score = 72.4 bits (176), Expect = 6e-11 Identities = 33/52 (63%), Positives = 45/52 (86%), Gaps = 2/52 (3%) Frame = +3 Query: 51 PLLFKLIPAVVHLGILLRWFTP--ETQIELGLKVDNLRSDSAKQRIALISKD 200 PLLFKLIPA++HLG+LLRWF+P E+ IE+G+K D+LRSDS K RI L++++ Sbjct: 544 PLLFKLIPAILHLGVLLRWFSPERESSIEVGIKADSLRSDSGKHRIILMAQE 595 >gb|EPS73308.1| hypothetical protein M569_01441 [Genlisea aurea] Length = 592 Score = 72.0 bits (175), Expect = 8e-11 Identities = 38/58 (65%), Positives = 48/58 (82%), Gaps = 3/58 (5%) Frame = +3 Query: 51 PLLFKLIPAVVHLGILLRWFTPETQIELG-LKVDNLRSDSAKQRIAL-ISKD-LIHEG 215 PLLFKLIPAVVHLG+LLRWF P++ E+G +K DN+R++ KQR+ L ISK+ LIHEG Sbjct: 535 PLLFKLIPAVVHLGVLLRWFPPDSSSEIGYIKGDNVRTEGVKQRMGLMISKELLIHEG 592 >ref|XP_007225682.1| hypothetical protein PRUPE_ppa003277mg [Prunus persica] gi|462422618|gb|EMJ26881.1| hypothetical protein PRUPE_ppa003277mg [Prunus persica] Length = 588 Score = 70.9 bits (172), Expect = 2e-10 Identities = 30/50 (60%), Positives = 40/50 (80%) Frame = +3 Query: 51 PLLFKLIPAVVHLGILLRWFTPETQIELGLKVDNLRSDSAKQRIALISKD 200 P LFKLIP +VHLG+LLRWF P+ +E+G K DNLR+DS KQR+ L+ ++ Sbjct: 535 PFLFKLIPGLVHLGVLLRWFPPDGAVEIGFKGDNLRTDSGKQRVILMVRE 584 >ref|XP_002308566.2| K+ efflux antiporter family protein [Populus trichocarpa] gi|550337019|gb|EEE92089.2| K+ efflux antiporter family protein [Populus trichocarpa] Length = 580 Score = 70.5 bits (171), Expect = 2e-10 Identities = 31/46 (67%), Positives = 40/46 (86%) Frame = +3 Query: 54 LLFKLIPAVVHLGILLRWFTPETQIELGLKVDNLRSDSAKQRIALI 191 LLFKLIPAV+HLG+LLRWF P++ +E+G K DN RSDS KQRI+++ Sbjct: 528 LLFKLIPAVMHLGVLLRWFPPDSAVEVGSKGDNFRSDSGKQRISVL 573 >ref|XP_004291032.1| PREDICTED: K(+) efflux antiporter 6-like [Fragaria vesca subsp. vesca] Length = 586 Score = 68.9 bits (167), Expect = 7e-10 Identities = 29/50 (58%), Positives = 40/50 (80%) Frame = +3 Query: 51 PLLFKLIPAVVHLGILLRWFTPETQIELGLKVDNLRSDSAKQRIALISKD 200 P LFKLIP +VHLG+LLRWF P+ +E+G K D+LR+DS KQR+ L+ ++ Sbjct: 533 PFLFKLIPGLVHLGVLLRWFPPDGAVEIGFKGDSLRTDSGKQRVILMVRE 582 >ref|XP_006451437.1| hypothetical protein CICLE_v10007842mg [Citrus clementina] gi|557554663|gb|ESR64677.1| hypothetical protein CICLE_v10007842mg [Citrus clementina] Length = 528 Score = 67.4 bits (163), Expect = 2e-09 Identities = 30/47 (63%), Positives = 41/47 (87%) Frame = +3 Query: 51 PLLFKLIPAVVHLGILLRWFTPETQIELGLKVDNLRSDSAKQRIALI 191 PLLFKLIPAVV+LG+LLRWF+P++ IE+G K D+LR+DSAK+ ++ Sbjct: 475 PLLFKLIPAVVNLGVLLRWFSPDSPIEIGYKGDSLRADSAKRITVMV 521 >ref|XP_006451436.1| hypothetical protein CICLE_v10007842mg [Citrus clementina] gi|568843015|ref|XP_006475420.1| PREDICTED: K(+) efflux antiporter 4-like isoform X1 [Citrus sinensis] gi|557554662|gb|ESR64676.1| hypothetical protein CICLE_v10007842mg [Citrus clementina] Length = 580 Score = 67.4 bits (163), Expect = 2e-09 Identities = 30/47 (63%), Positives = 41/47 (87%) Frame = +3 Query: 51 PLLFKLIPAVVHLGILLRWFTPETQIELGLKVDNLRSDSAKQRIALI 191 PLLFKLIPAVV+LG+LLRWF+P++ IE+G K D+LR+DSAK+ ++ Sbjct: 527 PLLFKLIPAVVNLGVLLRWFSPDSPIEIGYKGDSLRADSAKRITVMV 573 >ref|XP_006408878.1| hypothetical protein EUTSA_v10001937mg [Eutrema salsugineum] gi|557110034|gb|ESQ50331.1| hypothetical protein EUTSA_v10001937mg [Eutrema salsugineum] Length = 583 Score = 66.2 bits (160), Expect = 4e-09 Identities = 32/54 (59%), Positives = 43/54 (79%) Frame = +3 Query: 51 PLLFKLIPAVVHLGILLRWFTPETQIELGLKVDNLRSDSAKQRIALISKDLIHE 212 PLLFKLIPAVVHLG+LLRWF+P++ E+G K D S+SAK RI+L+ + +H+ Sbjct: 530 PLLFKLIPAVVHLGVLLRWFSPDSSSEIGFKGDLYHSESAK-RISLMIQGSLHD 582 >ref|XP_007012871.1| K+ efflux antiporter 4 isoform 3 [Theobroma cacao] gi|508783234|gb|EOY30490.1| K+ efflux antiporter 4 isoform 3 [Theobroma cacao] Length = 482 Score = 66.2 bits (160), Expect = 4e-09 Identities = 33/47 (70%), Positives = 39/47 (82%) Frame = +3 Query: 51 PLLFKLIPAVVHLGILLRWFTPETQIELGLKVDNLRSDSAKQRIALI 191 PLLFKLIPAVVHLG+LLRWF P+ E+G K D+LR+DSAK RI L+ Sbjct: 430 PLLFKLIPAVVHLGVLLRWFPPDGPSEIGFKGDSLRADSAK-RITLM 475