BLASTX nr result
ID: Mentha26_contig00017498
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00017498 (337 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU21861.1| hypothetical protein MIMGU_mgv1a008699mg [Mimulus... 70 2e-10 >gb|EYU21861.1| hypothetical protein MIMGU_mgv1a008699mg [Mimulus guttatus] Length = 365 Score = 70.5 bits (171), Expect = 2e-10 Identities = 47/105 (44%), Positives = 61/105 (58%), Gaps = 20/105 (19%) Frame = -2 Query: 255 MQVLASTTTRIVR-----------PISRSITTLPFSPLLPRKF--VRSFSPSQCRKAPRY 115 MQVLA ++IV PIS I +LPFSP LP + RS+S +C+ + + Sbjct: 1 MQVLAFQRSQIVLSSKNGGTNQIPPISALIHSLPFSPFLPIRVRPPRSYS-LRCKVSSKL 59 Query: 114 AASSRLIRSHALNVGTGSGGYEERKEN-------DSEQHTETSSK 1 SR IR+HALNVGTGSGGYE+ EN D +QH++ SSK Sbjct: 60 VLRSRTIRAHALNVGTGSGGYEDTHENNNQSSSLDGQQHSDASSK 104