BLASTX nr result
ID: Mentha26_contig00017285
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00017285 (340 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU46363.1| hypothetical protein MIMGU_mgv1a016147mg [Mimulus... 67 3e-09 gb|AFK35496.1| unknown [Medicago truncatula] 62 8e-08 ref|XP_004495024.1| PREDICTED: zinc finger HIT domain-containing... 61 2e-07 ref|NP_001238734.1| uncharacterized protein LOC100527614 [Glycin... 59 7e-07 ref|XP_004290030.1| PREDICTED: zinc finger HIT domain-containing... 59 9e-07 ref|XP_003542452.1| PREDICTED: zinc finger HIT domain-containing... 57 3e-06 >gb|EYU46363.1| hypothetical protein MIMGU_mgv1a016147mg [Mimulus guttatus] Length = 133 Score = 66.6 bits (161), Expect = 3e-09 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = -3 Query: 338 QKLIYNIDCSANPENELDKAMEDESFRLFTEKILSTI 228 QKLI +IDCSANPE+ELD+AM DESFRLFTEKILSTI Sbjct: 95 QKLIRDIDCSANPESELDRAMNDESFRLFTEKILSTI 131 >gb|AFK35496.1| unknown [Medicago truncatula] Length = 147 Score = 62.0 bits (149), Expect = 8e-08 Identities = 30/39 (76%), Positives = 33/39 (84%) Frame = -3 Query: 338 QKLIYNIDCSANPENELDKAMEDESFRLFTEKILSTIPP 222 Q+LI IDCS+N ENELDKAM DE+FRLFT KILSTI P Sbjct: 109 QELICQIDCSSNAENELDKAMADEAFRLFTNKILSTINP 147 >ref|XP_004495024.1| PREDICTED: zinc finger HIT domain-containing protein 3-like [Cicer arietinum] Length = 146 Score = 60.8 bits (146), Expect = 2e-07 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = -3 Query: 338 QKLIYNIDCSANPENELDKAMEDESFRLFTEKILSTIPP 222 Q+LI IDCS N ENELDKAM +E+FR+FTEKILSTI P Sbjct: 108 QELICRIDCSPNAENELDKAMAEEAFRMFTEKILSTINP 146 >ref|NP_001238734.1| uncharacterized protein LOC100527614 [Glycine max] gi|255632778|gb|ACU16742.1| unknown [Glycine max] Length = 132 Score = 58.9 bits (141), Expect = 7e-07 Identities = 28/39 (71%), Positives = 33/39 (84%) Frame = -3 Query: 338 QKLIYNIDCSANPENELDKAMEDESFRLFTEKILSTIPP 222 Q+LI IDCS+N ENELDKAM +E+FRL T+KILSTI P Sbjct: 94 QELICRIDCSSNAENELDKAMAEEAFRLLTDKILSTINP 132 >ref|XP_004290030.1| PREDICTED: zinc finger HIT domain-containing protein 3-like [Fragaria vesca subsp. vesca] Length = 146 Score = 58.5 bits (140), Expect = 9e-07 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = -3 Query: 338 QKLIYNIDCSANPENELDKAMEDESFRLFTEKILSTIPP 222 QKLI +IDCS + ENELDKAM+ E FRLFT+KILSTI P Sbjct: 108 QKLIESIDCSPDAENELDKAMDVEVFRLFTDKILSTINP 146 >ref|XP_003542452.1| PREDICTED: zinc finger HIT domain-containing protein 3-like isoform X1 [Glycine max] Length = 132 Score = 56.6 bits (135), Expect = 3e-06 Identities = 28/39 (71%), Positives = 33/39 (84%) Frame = -3 Query: 338 QKLIYNIDCSANPENELDKAMEDESFRLFTEKILSTIPP 222 Q+LI ID S+N ENELDKAM +E+FRLFT+KILSTI P Sbjct: 94 QELICRIDGSSNAENELDKAMAEEAFRLFTDKILSTINP 132