BLASTX nr result
ID: Mentha26_contig00017022
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00017022 (451 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU42796.1| hypothetical protein MIMGU_mgv1a021767mg [Mimulus... 62 6e-08 >gb|EYU42796.1| hypothetical protein MIMGU_mgv1a021767mg [Mimulus guttatus] Length = 247 Score = 62.4 bits (150), Expect = 6e-08 Identities = 31/36 (86%), Positives = 33/36 (91%), Gaps = 1/36 (2%) Frame = -1 Query: 106 IQPGVVKFAEGIKAFKLAFKKIV-KSGGDEDVLGPV 2 IQPGV KFAEGI AF+LAFKKIV KSGGDED+LGPV Sbjct: 146 IQPGVTKFAEGINAFRLAFKKIVKKSGGDEDILGPV 181