BLASTX nr result
ID: Mentha26_contig00016549
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00016549 (333 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007022200.1| ATP synthase delta-subunit gene [Theobroma c... 67 3e-09 ref|XP_003608818.1| ATP synthase [Medicago truncatula] gi|355509... 66 4e-09 sp|Q02758.1|ATPD_PEA RecName: Full=ATP synthase delta chain, chl... 64 2e-08 ref|XP_006360293.1| PREDICTED: ATP synthase delta chain, chlorop... 64 3e-08 ref|XP_004252554.1| PREDICTED: ATP synthase delta chain, chlorop... 64 3e-08 sp|P32980.1|ATPD_TOBAC RecName: Full=ATP synthase delta chain, c... 64 3e-08 ref|XP_004290445.1| PREDICTED: ATP synthase delta chain, chlorop... 62 8e-08 ref|XP_004138373.1| PREDICTED: ATP synthase delta chain, chlorop... 62 8e-08 ref|XP_006473233.1| PREDICTED: ATP synthase delta chain, chlorop... 62 1e-07 ref|XP_006434654.1| hypothetical protein CICLE_v10002351mg [Citr... 62 1e-07 ref|XP_006376336.1| hypothetical protein POPTR_0013s12130g [Popu... 62 1e-07 gb|EYU43559.1| hypothetical protein MIMGU_mgv1a012501mg [Mimulus... 61 1e-07 gb|EPS71748.1| hypothetical protein M569_03009, partial [Genlise... 61 2e-07 ref|XP_006287820.1| hypothetical protein CARUB_v10001038mg [Caps... 60 2e-07 ref|XP_002872455.1| hypothetical protein ARALYDRAFT_489817 [Arab... 60 2e-07 ref|XP_004515812.1| PREDICTED: ATP synthase delta chain, chlorop... 60 4e-07 ref|XP_007201374.1| hypothetical protein PRUPE_ppa010263mg [Prun... 60 4e-07 dbj|BAA11390.1| putative delta subunit of ATP synthase [Brassica... 59 5e-07 ref|XP_006397166.1| hypothetical protein EUTSA_v10028838mg [Eutr... 59 5e-07 ref|NP_192703.1| F-type H+-transporting ATPase subunit delta [Ar... 59 5e-07 >ref|XP_007022200.1| ATP synthase delta-subunit gene [Theobroma cacao] gi|508721828|gb|EOY13725.1| ATP synthase delta-subunit gene [Theobroma cacao] Length = 240 Score = 67.0 bits (162), Expect = 3e-09 Identities = 34/37 (91%), Positives = 34/37 (91%) Frame = +1 Query: 1 FTIRYGNSGSYFIDMSVKKQLEEIAEQLDLGDIQLAV 111 FTIRYGNSGS IDMSVKKQLEEIA QLDLGDIQLAV Sbjct: 204 FTIRYGNSGSKLIDMSVKKQLEEIAAQLDLGDIQLAV 240 >ref|XP_003608818.1| ATP synthase [Medicago truncatula] gi|355509873|gb|AES91015.1| ATP synthase [Medicago truncatula] Length = 249 Score = 66.2 bits (160), Expect = 4e-09 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = +1 Query: 1 FTIRYGNSGSYFIDMSVKKQLEEIAEQLDLGDIQLAV 111 FT+RYGNSGS FIDMSVKK+LEEIA QLDLGDI+LAV Sbjct: 213 FTVRYGNSGSKFIDMSVKKKLEEIASQLDLGDIKLAV 249 >sp|Q02758.1|ATPD_PEA RecName: Full=ATP synthase delta chain, chloroplastic; AltName: Full=F-ATPase delta chain; Flags: Precursor gi|169045|gb|AAA33647.1| ATP synthase delta subunit [Pisum sativum] Length = 251 Score = 64.3 bits (155), Expect = 2e-08 Identities = 30/37 (81%), Positives = 35/37 (94%) Frame = +1 Query: 1 FTIRYGNSGSYFIDMSVKKQLEEIAEQLDLGDIQLAV 111 FT+RYGN+GS FIDMSVK++LEEIA Q+DLGDIQLAV Sbjct: 215 FTVRYGNTGSKFIDMSVKRKLEEIAAQIDLGDIQLAV 251 >ref|XP_006360293.1| PREDICTED: ATP synthase delta chain, chloroplastic-like [Solanum tuberosum] Length = 250 Score = 63.5 bits (153), Expect = 3e-08 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = +1 Query: 1 FTIRYGNSGSYFIDMSVKKQLEEIAEQLDLGDIQLAV 111 FTIRYGNSGS IDMSVKKQLE+IA QL++GDIQLAV Sbjct: 214 FTIRYGNSGSKLIDMSVKKQLEDIAAQLEIGDIQLAV 250 >ref|XP_004252554.1| PREDICTED: ATP synthase delta chain, chloroplastic-like [Solanum lycopersicum] Length = 250 Score = 63.5 bits (153), Expect = 3e-08 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = +1 Query: 1 FTIRYGNSGSYFIDMSVKKQLEEIAEQLDLGDIQLAV 111 FTIRYGNSGS IDMSVKKQLE+IA QL++GDIQLAV Sbjct: 214 FTIRYGNSGSKLIDMSVKKQLEDIAAQLEIGDIQLAV 250 >sp|P32980.1|ATPD_TOBAC RecName: Full=ATP synthase delta chain, chloroplastic; AltName: Full=F-ATPase delta chain; Flags: Precursor gi|19787|emb|CAA45153.1| chloroplast ATP synthase (delta subunit) [Nicotiana tabacum] Length = 248 Score = 63.5 bits (153), Expect = 3e-08 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = +1 Query: 1 FTIRYGNSGSYFIDMSVKKQLEEIAEQLDLGDIQLAV 111 FTIRYGNSGS IDMSVKKQLE+IA QL++GDIQLAV Sbjct: 212 FTIRYGNSGSKLIDMSVKKQLEDIAAQLEIGDIQLAV 248 >ref|XP_004290445.1| PREDICTED: ATP synthase delta chain, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 250 Score = 62.0 bits (149), Expect = 8e-08 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = +1 Query: 1 FTIRYGNSGSYFIDMSVKKQLEEIAEQLDLGDIQL 105 FT+RYGNSGS IDMSVKKQLEEIA QLDLGDI+L Sbjct: 214 FTVRYGNSGSKLIDMSVKKQLEEIAAQLDLGDIKL 248 >ref|XP_004138373.1| PREDICTED: ATP synthase delta chain, chloroplastic-like [Cucumis sativus] gi|449503764|ref|XP_004162165.1| PREDICTED: ATP synthase delta chain, chloroplastic-like [Cucumis sativus] Length = 240 Score = 62.0 bits (149), Expect = 8e-08 Identities = 30/37 (81%), Positives = 34/37 (91%) Frame = +1 Query: 1 FTIRYGNSGSYFIDMSVKKQLEEIAEQLDLGDIQLAV 111 FT+R+GNSGS ID+SVKKQLEEIA QLDLG+IQLAV Sbjct: 204 FTVRFGNSGSKLIDLSVKKQLEEIAAQLDLGNIQLAV 240 >ref|XP_006473233.1| PREDICTED: ATP synthase delta chain, chloroplastic-like [Citrus sinensis] Length = 233 Score = 61.6 bits (148), Expect = 1e-07 Identities = 31/37 (83%), Positives = 32/37 (86%) Frame = +1 Query: 1 FTIRYGNSGSYFIDMSVKKQLEEIAEQLDLGDIQLAV 111 FTIRYG GS IDMSVKKQLEEIA QLDLGD+QLAV Sbjct: 197 FTIRYGKWGSKLIDMSVKKQLEEIAAQLDLGDVQLAV 233 >ref|XP_006434654.1| hypothetical protein CICLE_v10002351mg [Citrus clementina] gi|557536776|gb|ESR47894.1| hypothetical protein CICLE_v10002351mg [Citrus clementina] Length = 233 Score = 61.6 bits (148), Expect = 1e-07 Identities = 31/37 (83%), Positives = 32/37 (86%) Frame = +1 Query: 1 FTIRYGNSGSYFIDMSVKKQLEEIAEQLDLGDIQLAV 111 FTIRYG GS IDMSVKKQLEEIA QLDLGD+QLAV Sbjct: 197 FTIRYGKWGSKLIDMSVKKQLEEIAAQLDLGDVQLAV 233 >ref|XP_006376336.1| hypothetical protein POPTR_0013s12130g [Populus trichocarpa] gi|550325612|gb|ERP54133.1| hypothetical protein POPTR_0013s12130g [Populus trichocarpa] Length = 250 Score = 61.6 bits (148), Expect = 1e-07 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = +1 Query: 1 FTIRYGNSGSYFIDMSVKKQLEEIAEQLDLGDIQLA 108 FT+RYGNSGS IDMSVKKQLEEIA QLDL DI+LA Sbjct: 214 FTVRYGNSGSKLIDMSVKKQLEEIAAQLDLSDIELA 249 >gb|EYU43559.1| hypothetical protein MIMGU_mgv1a012501mg [Mimulus guttatus] Length = 248 Score = 61.2 bits (147), Expect = 1e-07 Identities = 30/37 (81%), Positives = 32/37 (86%) Frame = +1 Query: 1 FTIRYGNSGSYFIDMSVKKQLEEIAEQLDLGDIQLAV 111 FTIRYG +GS IDMSVKKQLEEI QLDLGDIQLA+ Sbjct: 212 FTIRYGETGSKLIDMSVKKQLEEITSQLDLGDIQLAL 248 >gb|EPS71748.1| hypothetical protein M569_03009, partial [Genlisea aurea] Length = 190 Score = 60.8 bits (146), Expect = 2e-07 Identities = 29/36 (80%), Positives = 33/36 (91%) Frame = +1 Query: 1 FTIRYGNSGSYFIDMSVKKQLEEIAEQLDLGDIQLA 108 FTIRYGN+GS ID+SVKKQLEEIA QL++GDIQLA Sbjct: 155 FTIRYGNTGSKLIDLSVKKQLEEIAAQLEIGDIQLA 190 >ref|XP_006287820.1| hypothetical protein CARUB_v10001038mg [Capsella rubella] gi|482556526|gb|EOA20718.1| hypothetical protein CARUB_v10001038mg [Capsella rubella] Length = 422 Score = 60.5 bits (145), Expect = 2e-07 Identities = 29/36 (80%), Positives = 34/36 (94%) Frame = +1 Query: 1 FTIRYGNSGSYFIDMSVKKQLEEIAEQLDLGDIQLA 108 FTIRYG+SGS IDMSVKKQLE+IA+QL+LG+IQLA Sbjct: 386 FTIRYGDSGSKLIDMSVKKQLEDIAQQLELGEIQLA 421 >ref|XP_002872455.1| hypothetical protein ARALYDRAFT_489817 [Arabidopsis lyrata subsp. lyrata] gi|297318292|gb|EFH48714.1| hypothetical protein ARALYDRAFT_489817 [Arabidopsis lyrata subsp. lyrata] Length = 233 Score = 60.5 bits (145), Expect = 2e-07 Identities = 29/36 (80%), Positives = 34/36 (94%) Frame = +1 Query: 1 FTIRYGNSGSYFIDMSVKKQLEEIAEQLDLGDIQLA 108 FTIRYG+SGS IDMSVKKQLE+IA+QL+LG+IQLA Sbjct: 197 FTIRYGDSGSKLIDMSVKKQLEDIAQQLELGEIQLA 232 >ref|XP_004515812.1| PREDICTED: ATP synthase delta chain, chloroplastic-like [Cicer arietinum] Length = 252 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/37 (75%), Positives = 34/37 (91%) Frame = +1 Query: 1 FTIRYGNSGSYFIDMSVKKQLEEIAEQLDLGDIQLAV 111 FT+RYGN+GS FID+SVKK+LEEIA Q+ LGDI+LAV Sbjct: 216 FTVRYGNAGSKFIDLSVKKKLEEIAAQIALGDIKLAV 252 >ref|XP_007201374.1| hypothetical protein PRUPE_ppa010263mg [Prunus persica] gi|462396774|gb|EMJ02573.1| hypothetical protein PRUPE_ppa010263mg [Prunus persica] Length = 257 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = +1 Query: 1 FTIRYGNSGSYFIDMSVKKQLEEIAEQLDLGDIQL 105 FT+RYGNSGS ID+SVKKQLEEIA +LDLGDI+L Sbjct: 221 FTVRYGNSGSKLIDLSVKKQLEEIAAELDLGDIKL 255 >dbj|BAA11390.1| putative delta subunit of ATP synthase [Brassica rapa] Length = 134 Score = 59.3 bits (142), Expect = 5e-07 Identities = 29/36 (80%), Positives = 33/36 (91%) Frame = +1 Query: 1 FTIRYGNSGSYFIDMSVKKQLEEIAEQLDLGDIQLA 108 FTIRYG+SGS IDMSVKKQLE+IA QL+LG+IQLA Sbjct: 98 FTIRYGDSGSKLIDMSVKKQLEDIAAQLELGEIQLA 133 >ref|XP_006397166.1| hypothetical protein EUTSA_v10028838mg [Eutrema salsugineum] gi|557098183|gb|ESQ38619.1| hypothetical protein EUTSA_v10028838mg [Eutrema salsugineum] Length = 303 Score = 59.3 bits (142), Expect = 5e-07 Identities = 29/36 (80%), Positives = 33/36 (91%) Frame = +1 Query: 1 FTIRYGNSGSYFIDMSVKKQLEEIAEQLDLGDIQLA 108 FTIRYG+SGS IDMSVKKQLE+IA QL+LG+IQLA Sbjct: 267 FTIRYGDSGSKLIDMSVKKQLEDIAAQLELGEIQLA 302 >ref|NP_192703.1| F-type H+-transporting ATPase subunit delta [Arabidopsis thaliana] gi|7267660|emb|CAB78088.1| H+-transporting ATP synthase-like protein [Arabidopsis thaliana] gi|7321084|emb|CAB82132.1| H+-transporting ATP synthase-like protein [Arabidopsis thaliana] gi|17473800|gb|AAL38334.1| H+-transporting ATP synthase-like protein [Arabidopsis thaliana] gi|21386985|gb|AAM47896.1| H+-transporting ATP synthase-like protein [Arabidopsis thaliana] gi|21593484|gb|AAM65451.1| H+-transporting ATP synthase-like protein [Arabidopsis thaliana] gi|21689783|gb|AAM67535.1| putative H+-transporting ATP synthase [Arabidopsis thaliana] gi|332657377|gb|AEE82777.1| F-type H+-transporting ATPase subunit delta [Arabidopsis thaliana] Length = 234 Score = 59.3 bits (142), Expect = 5e-07 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = +1 Query: 1 FTIRYGNSGSYFIDMSVKKQLEEIAEQLDLGDIQLA 108 FTIRYG SGS IDMSVKKQLE+IA QL+LG+IQLA Sbjct: 198 FTIRYGESGSKLIDMSVKKQLEDIASQLELGEIQLA 233