BLASTX nr result
ID: Mentha26_contig00016379
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00016379 (608 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002516773.1| Protein SSM1, putative [Ricinus communis] gi... 39 3e-06 >ref|XP_002516773.1| Protein SSM1, putative [Ricinus communis] gi|223543861|gb|EEF45387.1| Protein SSM1, putative [Ricinus communis] Length = 264 Score = 38.9 bits (89), Expect(2) = 3e-06 Identities = 19/32 (59%), Positives = 21/32 (65%) Frame = +3 Query: 93 WMKEEGGGEDKRINSHDRNEMDSIIAPTSVGA 188 WM E G D R S R+EMDSI+APT VGA Sbjct: 233 WMSGEDSGGDGRRISRTRSEMDSILAPTPVGA 264 Score = 38.1 bits (87), Expect(2) = 3e-06 Identities = 17/28 (60%), Positives = 21/28 (75%) Frame = +2 Query: 2 VGRARKSKEADYAIEKVRSMGQLIPEIW 85 VG+ KSKEADY +E V + Q+IPEIW Sbjct: 206 VGKTVKSKEADYLLEYVIKLPQVIPEIW 233