BLASTX nr result
ID: Mentha26_contig00016278
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00016278 (429 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB62433.1| Phosphoribosylamine--glycine ligase [Morus notabi... 76 4e-12 ref|XP_006349318.1| PREDICTED: phosphoribosylamine--glycine liga... 76 4e-12 ref|XP_007041208.1| Glycinamide ribonucleotide (GAR) synthetase ... 75 7e-12 ref|XP_007041207.1| Glycinamide ribonucleotide (GAR) synthetase ... 75 7e-12 ref|XP_006431614.1| hypothetical protein CICLE_v10000877mg [Citr... 75 1e-11 ref|XP_006588509.1| PREDICTED: phosphoribosylamine--glycine liga... 74 2e-11 ref|XP_006588507.1| PREDICTED: phosphoribosylamine--glycine liga... 74 2e-11 ref|XP_006385046.1| hypothetical protein POPTR_0004s23390g [Popu... 74 3e-11 gb|AAR06584.1| glycinamide ribonucleotide synthetase [Nicotiana ... 74 3e-11 ref|XP_006492599.1| PREDICTED: phosphoribosylamine--glycine liga... 73 4e-11 ref|XP_002526442.1| phosphoribosylamine-glycine ligase, putative... 73 4e-11 ref|XP_007144756.1| hypothetical protein PHAVU_007G182100g [Phas... 73 5e-11 ref|XP_004230444.1| PREDICTED: phosphoribosylamine--glycine liga... 73 5e-11 ref|XP_003612465.1| Phosphoribosylamine-glycine ligase [Medicago... 72 6e-11 ref|XP_002269017.2| PREDICTED: phosphoribosylamine--glycine liga... 71 1e-10 emb|CBI32977.3| unnamed protein product [Vitis vinifera] 71 1e-10 ref|XP_006307232.1| hypothetical protein CARUB_v10008837mg [Caps... 69 9e-10 ref|NP_172454.1| phosphoribosylamine--glycine ligase [Arabidopsi... 68 1e-09 gb|EYU33276.1| hypothetical protein MIMGU_mgv1a003947mg [Mimulus... 67 3e-09 ref|XP_006417528.1| hypothetical protein EUTSA_v10007333mg [Eutr... 67 3e-09 >gb|EXB62433.1| Phosphoribosylamine--glycine ligase [Morus notabilis] Length = 505 Score = 76.3 bits (186), Expect = 4e-12 Identities = 31/43 (72%), Positives = 38/43 (88%) Frame = +1 Query: 1 GKDLQEARDRAYEAVEHVNWPRGFYRRDIGWRALARKQYAARG 129 GKDL+EARDRAY+AVE +NWP GFYRRDIGWRAL +K++ +G Sbjct: 463 GKDLEEARDRAYQAVEQINWPGGFYRRDIGWRALPQKEFVTKG 505 >ref|XP_006349318.1| PREDICTED: phosphoribosylamine--glycine ligase, chloroplastic-like [Solanum tuberosum] Length = 514 Score = 76.3 bits (186), Expect = 4e-12 Identities = 32/40 (80%), Positives = 37/40 (92%) Frame = +1 Query: 1 GKDLQEARDRAYEAVEHVNWPRGFYRRDIGWRALARKQYA 120 GKDL+EARDRAY+AVE +NWP GFYRRDIGWRAL +KQY+ Sbjct: 475 GKDLEEARDRAYQAVEQINWPGGFYRRDIGWRALPQKQYS 514 >ref|XP_007041208.1| Glycinamide ribonucleotide (GAR) synthetase isoform 2 [Theobroma cacao] gi|508705143|gb|EOX97039.1| Glycinamide ribonucleotide (GAR) synthetase isoform 2 [Theobroma cacao] Length = 530 Score = 75.5 bits (184), Expect = 7e-12 Identities = 31/40 (77%), Positives = 37/40 (92%) Frame = +1 Query: 1 GKDLQEARDRAYEAVEHVNWPRGFYRRDIGWRALARKQYA 120 G+DL+EARDRAY+AVE +NWP GFYRRDIGWRAL +KQ+A Sbjct: 488 GRDLEEARDRAYQAVEEINWPEGFYRRDIGWRALPQKQFA 527 >ref|XP_007041207.1| Glycinamide ribonucleotide (GAR) synthetase isoform 1 [Theobroma cacao] gi|508705142|gb|EOX97038.1| Glycinamide ribonucleotide (GAR) synthetase isoform 1 [Theobroma cacao] Length = 508 Score = 75.5 bits (184), Expect = 7e-12 Identities = 31/40 (77%), Positives = 37/40 (92%) Frame = +1 Query: 1 GKDLQEARDRAYEAVEHVNWPRGFYRRDIGWRALARKQYA 120 G+DL+EARDRAY+AVE +NWP GFYRRDIGWRAL +KQ+A Sbjct: 466 GRDLEEARDRAYQAVEEINWPEGFYRRDIGWRALPQKQFA 505 >ref|XP_006431614.1| hypothetical protein CICLE_v10000877mg [Citrus clementina] gi|557533736|gb|ESR44854.1| hypothetical protein CICLE_v10000877mg [Citrus clementina] Length = 518 Score = 74.7 bits (182), Expect = 1e-11 Identities = 32/42 (76%), Positives = 37/42 (88%) Frame = +1 Query: 1 GKDLQEARDRAYEAVEHVNWPRGFYRRDIGWRALARKQYAAR 126 GKD++EARDRAY AVE +NWP GFYRRDIGWRAL +KQ+A R Sbjct: 476 GKDVEEARDRAYLAVEEINWPGGFYRRDIGWRALPQKQFATR 517 >ref|XP_006588509.1| PREDICTED: phosphoribosylamine--glycine ligase isoform X3 [Glycine max] Length = 527 Score = 73.9 bits (180), Expect = 2e-11 Identities = 32/43 (74%), Positives = 36/43 (83%) Frame = +1 Query: 1 GKDLQEARDRAYEAVEHVNWPRGFYRRDIGWRALARKQYAARG 129 G DL+EARDRAY+AVE VNW GFYRRDIGWRAL +KQY +G Sbjct: 485 GNDLEEARDRAYQAVEKVNWSGGFYRRDIGWRALPQKQYVTKG 527 >ref|XP_006588507.1| PREDICTED: phosphoribosylamine--glycine ligase isoform X1 [Glycine max] gi|571480949|ref|XP_006588508.1| PREDICTED: phosphoribosylamine--glycine ligase isoform X2 [Glycine max] Length = 528 Score = 73.9 bits (180), Expect = 2e-11 Identities = 32/43 (74%), Positives = 36/43 (83%) Frame = +1 Query: 1 GKDLQEARDRAYEAVEHVNWPRGFYRRDIGWRALARKQYAARG 129 G DL+EARDRAY+AVE VNW GFYRRDIGWRAL +KQY +G Sbjct: 486 GNDLEEARDRAYQAVEKVNWSGGFYRRDIGWRALPQKQYVTKG 528 >ref|XP_006385046.1| hypothetical protein POPTR_0004s23390g [Populus trichocarpa] gi|550341814|gb|ERP62843.1| hypothetical protein POPTR_0004s23390g [Populus trichocarpa] Length = 528 Score = 73.6 bits (179), Expect = 3e-11 Identities = 31/42 (73%), Positives = 37/42 (88%) Frame = +1 Query: 1 GKDLQEARDRAYEAVEHVNWPRGFYRRDIGWRALARKQYAAR 126 G+DL+EARDRAY+AVE +NWP GFYRRDIGWRAL +KQ A + Sbjct: 486 GRDLEEARDRAYQAVEEINWPGGFYRRDIGWRALPQKQLAPK 527 >gb|AAR06584.1| glycinamide ribonucleotide synthetase [Nicotiana tabacum] Length = 515 Score = 73.6 bits (179), Expect = 3e-11 Identities = 30/40 (75%), Positives = 38/40 (95%) Frame = +1 Query: 1 GKDLQEARDRAYEAVEHVNWPRGFYRRDIGWRALARKQYA 120 G+DL+EARDRAY+AVE ++WP GFYRRDIGWRAL++KQY+ Sbjct: 476 GEDLEEARDRAYQAVEQISWPGGFYRRDIGWRALSQKQYS 515 >ref|XP_006492599.1| PREDICTED: phosphoribosylamine--glycine ligase, chloroplastic-like [Citrus sinensis] Length = 517 Score = 73.2 bits (178), Expect = 4e-11 Identities = 31/42 (73%), Positives = 37/42 (88%) Frame = +1 Query: 1 GKDLQEARDRAYEAVEHVNWPRGFYRRDIGWRALARKQYAAR 126 GKD++EA+DRAY AVE +NWP GFYRRDIGWRAL +KQ+A R Sbjct: 475 GKDVEEAQDRAYLAVEEINWPGGFYRRDIGWRALPQKQFATR 516 >ref|XP_002526442.1| phosphoribosylamine-glycine ligase, putative [Ricinus communis] gi|223534222|gb|EEF35937.1| phosphoribosylamine-glycine ligase, putative [Ricinus communis] Length = 534 Score = 73.2 bits (178), Expect = 4e-11 Identities = 30/40 (75%), Positives = 36/40 (90%) Frame = +1 Query: 1 GKDLQEARDRAYEAVEHVNWPRGFYRRDIGWRALARKQYA 120 G+DLQEA+DRAY+AVE +NWP GFYRRDIGWRA +KQ+A Sbjct: 492 GRDLQEAKDRAYQAVEEINWPGGFYRRDIGWRAFPQKQFA 531 >ref|XP_007144756.1| hypothetical protein PHAVU_007G182100g [Phaseolus vulgaris] gi|561017946|gb|ESW16750.1| hypothetical protein PHAVU_007G182100g [Phaseolus vulgaris] Length = 527 Score = 72.8 bits (177), Expect = 5e-11 Identities = 32/42 (76%), Positives = 36/42 (85%) Frame = +1 Query: 1 GKDLQEARDRAYEAVEHVNWPRGFYRRDIGWRALARKQYAAR 126 G DL+EA DRAY AVE+VNWP GFYRRDIGWRAL +KQYA + Sbjct: 485 GNDLEEACDRAYRAVENVNWPGGFYRRDIGWRALPQKQYAKK 526 >ref|XP_004230444.1| PREDICTED: phosphoribosylamine--glycine ligase, chloroplastic-like [Solanum lycopersicum] Length = 514 Score = 72.8 bits (177), Expect = 5e-11 Identities = 31/40 (77%), Positives = 36/40 (90%) Frame = +1 Query: 1 GKDLQEARDRAYEAVEHVNWPRGFYRRDIGWRALARKQYA 120 GKDL+EARDRAY+AVE +NW GFYRRDIGWRAL +KQY+ Sbjct: 475 GKDLEEARDRAYQAVEQINWACGFYRRDIGWRALPQKQYS 514 >ref|XP_003612465.1| Phosphoribosylamine-glycine ligase [Medicago truncatula] gi|355513800|gb|AES95423.1| Phosphoribosylamine-glycine ligase [Medicago truncatula] Length = 532 Score = 72.4 bits (176), Expect = 6e-11 Identities = 31/42 (73%), Positives = 38/42 (90%) Frame = +1 Query: 1 GKDLQEARDRAYEAVEHVNWPRGFYRRDIGWRALARKQYAAR 126 G DL+EA DRAY+AVE+VNWP GFYRRDIGWRAL +KQ+A++ Sbjct: 490 GNDLEEACDRAYQAVENVNWPGGFYRRDIGWRALPQKQHASK 531 >ref|XP_002269017.2| PREDICTED: phosphoribosylamine--glycine ligase, chloroplastic [Vitis vinifera] Length = 547 Score = 71.2 bits (173), Expect = 1e-10 Identities = 30/42 (71%), Positives = 36/42 (85%) Frame = +1 Query: 1 GKDLQEARDRAYEAVEHVNWPRGFYRRDIGWRALARKQYAAR 126 GK+L+EAR+RAY AVE +NWP GFYRRDIGWRAL R Q+A + Sbjct: 505 GKNLEEARERAYRAVEEINWPGGFYRRDIGWRALPRGQFATK 546 >emb|CBI32977.3| unnamed protein product [Vitis vinifera] Length = 527 Score = 71.2 bits (173), Expect = 1e-10 Identities = 30/42 (71%), Positives = 36/42 (85%) Frame = +1 Query: 1 GKDLQEARDRAYEAVEHVNWPRGFYRRDIGWRALARKQYAAR 126 GK+L+EAR+RAY AVE +NWP GFYRRDIGWRAL R Q+A + Sbjct: 485 GKNLEEARERAYRAVEEINWPGGFYRRDIGWRALPRGQFATK 526 >ref|XP_006307232.1| hypothetical protein CARUB_v10008837mg [Capsella rubella] gi|482575943|gb|EOA40130.1| hypothetical protein CARUB_v10008837mg [Capsella rubella] Length = 526 Score = 68.6 bits (166), Expect = 9e-10 Identities = 28/40 (70%), Positives = 34/40 (85%) Frame = +1 Query: 1 GKDLQEARDRAYEAVEHVNWPRGFYRRDIGWRALARKQYA 120 G DL+EARD+AY AV+ +NWP GF+RRDIGWRAL +KQ A Sbjct: 482 GNDLEEARDKAYSAVQQINWPEGFFRRDIGWRALRQKQVA 521 >ref|NP_172454.1| phosphoribosylamine--glycine ligase [Arabidopsis thaliana] gi|12644306|sp|P52420.2|PUR2_ARATH RecName: Full=Phosphoribosylamine--glycine ligase, chloroplastic; AltName: Full=Glycinamide ribonucleotide synthetase; Short=GARS; AltName: Full=Phosphoribosylglycinamide synthetase; Flags: Precursor gi|2160174|gb|AAB60737.1| Identical to A. thaliana PUR2 (gb|X74766). ESTs gb|ATTS3927,gb|N96446 come from this gene [Arabidopsis thaliana] gi|15292773|gb|AAK92755.1| putative phosphoribosylglycinamide synthetase [Arabidopsis thaliana] gi|20259251|gb|AAM14361.1| putative phosphoribosylglycinamide synthetase [Arabidopsis thaliana] gi|332190379|gb|AEE28500.1| phosphoribosylamine--glycine ligase [Arabidopsis thaliana] Length = 532 Score = 68.2 bits (165), Expect = 1e-09 Identities = 28/42 (66%), Positives = 35/42 (83%) Frame = +1 Query: 1 GKDLQEARDRAYEAVEHVNWPRGFYRRDIGWRALARKQYAAR 126 GKDL+EAR+RAY AV+ +NWP GF+R DIGWRAL +KQ A + Sbjct: 489 GKDLEEARERAYSAVQQINWPGGFFRHDIGWRALRQKQVATK 530 >gb|EYU33276.1| hypothetical protein MIMGU_mgv1a003947mg [Mimulus guttatus] Length = 553 Score = 67.0 bits (162), Expect = 3e-09 Identities = 28/39 (71%), Positives = 33/39 (84%) Frame = +1 Query: 1 GKDLQEARDRAYEAVEHVNWPRGFYRRDIGWRALARKQY 117 G +L EARDR Y+AV+ VNWP GFYRRDIGWRAL +KQ+ Sbjct: 510 GANLAEARDRVYQAVDQVNWPEGFYRRDIGWRALPQKQH 548 >ref|XP_006417528.1| hypothetical protein EUTSA_v10007333mg [Eutrema salsugineum] gi|557095299|gb|ESQ35881.1| hypothetical protein EUTSA_v10007333mg [Eutrema salsugineum] Length = 533 Score = 67.0 bits (162), Expect = 3e-09 Identities = 28/42 (66%), Positives = 36/42 (85%) Frame = +1 Query: 1 GKDLQEARDRAYEAVEHVNWPRGFYRRDIGWRALARKQYAAR 126 GKDL+EAR+RAY AV+ ++WP GF+RRDIGWRAL +KQ A + Sbjct: 491 GKDLEEARERAYGAVQQIHWPGGFFRRDIGWRALRQKQVAIK 532