BLASTX nr result
ID: Mentha26_contig00015401
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00015401 (328 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFV46221.1| hypothetical protein, partial [Scutellaria baical... 73 4e-11 >gb|AFV46221.1| hypothetical protein, partial [Scutellaria baicalensis] Length = 459 Score = 73.2 bits (178), Expect = 4e-11 Identities = 44/83 (53%), Positives = 49/83 (59%), Gaps = 4/83 (4%) Frame = -2 Query: 255 MSLVGSAALFRGRELYSLKDDNVSSGLSTSGFYSDSDSYDPKYFLDSPSSSDVLGNPFHS 76 MSLV SA++FR ELY L+DDN SS +S S SYDPKYF DSPS DV FH Sbjct: 1 MSLVRSASMFRSNELYLLEDDNDSSVISMS-------SYDPKYFSDSPSMCDVSETSFHR 53 Query: 75 DLVASTHN----SFGYASELDSP 19 +S H F Y SELDSP Sbjct: 54 HQTSSYHRENPYQFNYDSELDSP 76