BLASTX nr result
ID: Mentha26_contig00014931
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00014931 (402 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS67133.1| hypothetical protein M569_07641 [Genlisea aurea] 57 2e-06 >gb|EPS67133.1| hypothetical protein M569_07641 [Genlisea aurea] Length = 128 Score = 57.4 bits (137), Expect = 2e-06 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = +1 Query: 4 VSEPEIRSAQRVEREASELKGTMKKRMNFLDMD 102 VSE EIR AQ+ EREASELKGTMKKRM+FLDMD Sbjct: 96 VSEAEIRRAQKAEREASELKGTMKKRMDFLDMD 128