BLASTX nr result
ID: Mentha26_contig00014794
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00014794 (312 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU41687.1| hypothetical protein MIMGU_mgv1a013331mg [Mimulus... 60 3e-07 gb|EYU41686.1| hypothetical protein MIMGU_mgv1a013331mg [Mimulus... 60 3e-07 gb|EPS67283.1| hypothetical protein M569_07492, partial [Genlise... 57 2e-06 >gb|EYU41687.1| hypothetical protein MIMGU_mgv1a013331mg [Mimulus guttatus] Length = 223 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/33 (81%), Positives = 32/33 (96%) Frame = +3 Query: 3 VAVDEFLPATKAYEAIQNSMDLYGEYTLENLRR 101 VAVDEFLPATKAYEA+Q+SM+LY +YT+ENLRR Sbjct: 191 VAVDEFLPATKAYEAVQSSMNLYADYTVENLRR 223 >gb|EYU41686.1| hypothetical protein MIMGU_mgv1a013331mg [Mimulus guttatus] Length = 215 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/33 (81%), Positives = 32/33 (96%) Frame = +3 Query: 3 VAVDEFLPATKAYEAIQNSMDLYGEYTLENLRR 101 VAVDEFLPATKAYEA+Q+SM+LY +YT+ENLRR Sbjct: 183 VAVDEFLPATKAYEAVQSSMNLYADYTVENLRR 215 >gb|EPS67283.1| hypothetical protein M569_07492, partial [Genlisea aurea] Length = 212 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = +3 Query: 3 VAVDEFLPATKAYEAIQNSMDLYGEYTLENLRR 101 VAVD+FLPA +AYEA+QNSMDLY EY +ENLRR Sbjct: 180 VAVDKFLPAQQAYEAVQNSMDLYAEYIVENLRR 212