BLASTX nr result
ID: Mentha26_contig00014770
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00014770 (461 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007040387.1| Calcium-dependent protein kinase 6 isoform 1... 99 5e-19 ref|XP_003538256.1| PREDICTED: calcium-dependent protein kinase ... 97 3e-18 ref|XP_006283520.1| hypothetical protein CARUB_v10004572mg [Caps... 94 2e-17 ref|XP_006476469.1| PREDICTED: calcium-dependent protein kinase ... 94 3e-17 ref|XP_006439443.1| hypothetical protein CICLE_v10019724mg [Citr... 94 3e-17 ref|XP_002298000.1| calcium-dependent protein kinase 1 [Populus ... 94 3e-17 ref|XP_003517491.2| PREDICTED: calcium-dependent protein kinase ... 92 6e-17 ref|XP_007160124.1| hypothetical protein PHAVU_002G294500g [Phas... 92 6e-17 ref|XP_004511540.1| PREDICTED: calcium-dependent protein kinase ... 92 6e-17 gb|AHN16201.1| CPK3-2.1 [Brassica napus] 92 8e-17 gb|AGG35973.1| calcium-dependent protein kinase 3, partial [Bras... 92 8e-17 ref|XP_004298849.1| PREDICTED: calcium-dependent protein kinase ... 92 1e-16 ref|XP_003525360.1| PREDICTED: calcium-dependent protein kinase ... 92 1e-16 gb|AGS15000.1| calcium-dependent protein kinase 3 [Vitis amurensis] 91 1e-16 ref|XP_004503656.1| PREDICTED: calcium-dependent protein kinase ... 91 1e-16 ref|XP_002867697.1| calcium-dependent protein kinase 6 [Arabidop... 91 1e-16 emb|CBI34415.3| unnamed protein product [Vitis vinifera] 91 1e-16 ref|XP_002272270.1| PREDICTED: calcium-dependent protein kinase ... 91 1e-16 emb|CAN61364.1| hypothetical protein VITISV_032639 [Vitis vinifera] 91 1e-16 ref|NP_194096.1| calcium-dependent protein kinase 6 [Arabidopsis... 91 1e-16 >ref|XP_007040387.1| Calcium-dependent protein kinase 6 isoform 1 [Theobroma cacao] gi|508777632|gb|EOY24888.1| Calcium-dependent protein kinase 6 isoform 1 [Theobroma cacao] Length = 531 Score = 99.4 bits (246), Expect = 5e-19 Identities = 45/53 (84%), Positives = 51/53 (96%) Frame = -3 Query: 459 EQALKKYNMGDDKTIKEILAEVDTDNDGKINYDEFVAMMKKGNPDIGGNRRRK 301 EQAL+KYNMGD+KTIKEI+AEVDTD DG+INYDEFVAMM+KGNPD+ GNRRRK Sbjct: 479 EQALRKYNMGDEKTIKEIIAEVDTDRDGRINYDEFVAMMRKGNPDLVGNRRRK 531 >ref|XP_003538256.1| PREDICTED: calcium-dependent protein kinase 3-like isoform 1 [Glycine max] Length = 505 Score = 96.7 bits (239), Expect = 3e-18 Identities = 44/53 (83%), Positives = 49/53 (92%) Frame = -3 Query: 459 EQALKKYNMGDDKTIKEILAEVDTDNDGKINYDEFVAMMKKGNPDIGGNRRRK 301 E ALKKYNMGD+KTIKEI+AEVD DNDG+INYDEFVAMM+KGNPD+ NRRRK Sbjct: 453 ESALKKYNMGDEKTIKEIIAEVDADNDGRINYDEFVAMMRKGNPDLVNNRRRK 505 >ref|XP_006283520.1| hypothetical protein CARUB_v10004572mg [Capsella rubella] gi|186701235|gb|ACC91261.1| putative calcium-dependent protein kinase [Capsella rubella] gi|482552225|gb|EOA16418.1| hypothetical protein CARUB_v10004572mg [Capsella rubella] Length = 529 Score = 94.0 bits (232), Expect = 2e-17 Identities = 43/52 (82%), Positives = 49/52 (94%) Frame = -3 Query: 459 EQALKKYNMGDDKTIKEILAEVDTDNDGKINYDEFVAMMKKGNPDIGGNRRR 304 EQA+KKYNMGDDK+IKEI+AEVDTD DGKINY+EFVAMMKKGNP++ NRRR Sbjct: 476 EQAMKKYNMGDDKSIKEIIAEVDTDRDGKINYEEFVAMMKKGNPELVTNRRR 527 >ref|XP_006476469.1| PREDICTED: calcium-dependent protein kinase 3-like [Citrus sinensis] Length = 520 Score = 93.6 bits (231), Expect = 3e-17 Identities = 43/53 (81%), Positives = 48/53 (90%) Frame = -3 Query: 459 EQALKKYNMGDDKTIKEILAEVDTDNDGKINYDEFVAMMKKGNPDIGGNRRRK 301 E ALKKYNMGD KTIKEI+AEVD DNDG+INY+EF AMM+KGNPD+ GNRRRK Sbjct: 468 EHALKKYNMGDAKTIKEIIAEVDIDNDGRINYEEFAAMMRKGNPDMVGNRRRK 520 >ref|XP_006439443.1| hypothetical protein CICLE_v10019724mg [Citrus clementina] gi|557541705|gb|ESR52683.1| hypothetical protein CICLE_v10019724mg [Citrus clementina] Length = 520 Score = 93.6 bits (231), Expect = 3e-17 Identities = 43/53 (81%), Positives = 48/53 (90%) Frame = -3 Query: 459 EQALKKYNMGDDKTIKEILAEVDTDNDGKINYDEFVAMMKKGNPDIGGNRRRK 301 E ALKKYNMGD KTIKEI+AEVD DNDG+INY+EF AMM+KGNPD+ GNRRRK Sbjct: 468 EHALKKYNMGDAKTIKEIIAEVDIDNDGRINYEEFAAMMRKGNPDMVGNRRRK 520 >ref|XP_002298000.1| calcium-dependent protein kinase 1 [Populus trichocarpa] gi|222845258|gb|EEE82805.1| calcium-dependent protein kinase 1 [Populus trichocarpa] Length = 515 Score = 93.6 bits (231), Expect = 3e-17 Identities = 42/53 (79%), Positives = 49/53 (92%) Frame = -3 Query: 459 EQALKKYNMGDDKTIKEILAEVDTDNDGKINYDEFVAMMKKGNPDIGGNRRRK 301 EQAL KYNMGD KTIKEI+AEVDTD+DG+INY+EFVAMM+KGNP++ NRRRK Sbjct: 463 EQALMKYNMGDSKTIKEIIAEVDTDHDGRINYEEFVAMMRKGNPELASNRRRK 515 >ref|XP_003517491.2| PREDICTED: calcium-dependent protein kinase 3-like [Glycine max] Length = 528 Score = 92.4 bits (228), Expect = 6e-17 Identities = 42/53 (79%), Positives = 47/53 (88%) Frame = -3 Query: 459 EQALKKYNMGDDKTIKEILAEVDTDNDGKINYDEFVAMMKKGNPDIGGNRRRK 301 E LKKYNMGD+KTIKEI+ EVDTDNDG+INYDEFVAMM+KG PD+ NRRRK Sbjct: 476 ESTLKKYNMGDEKTIKEIIVEVDTDNDGRINYDEFVAMMRKGKPDLVTNRRRK 528 >ref|XP_007160124.1| hypothetical protein PHAVU_002G294500g [Phaseolus vulgaris] gi|561033539|gb|ESW32118.1| hypothetical protein PHAVU_002G294500g [Phaseolus vulgaris] Length = 519 Score = 92.4 bits (228), Expect = 6e-17 Identities = 45/55 (81%), Positives = 49/55 (89%), Gaps = 2/55 (3%) Frame = -3 Query: 459 EQALKKYNMGDDKTIKEILAEVDTDNDGKINYDEFVAMMKKGNPDIG--GNRRRK 301 E ALKKYNMGD+KTIKEI+AEVDTDNDG+INYDEFVAMM+KGNPDI RRRK Sbjct: 465 ESALKKYNMGDEKTIKEIIAEVDTDNDGRINYDEFVAMMRKGNPDISHITQRRRK 519 >ref|XP_004511540.1| PREDICTED: calcium-dependent protein kinase 3-like [Cicer arietinum] Length = 509 Score = 92.4 bits (228), Expect = 6e-17 Identities = 42/53 (79%), Positives = 49/53 (92%) Frame = -3 Query: 459 EQALKKYNMGDDKTIKEILAEVDTDNDGKINYDEFVAMMKKGNPDIGGNRRRK 301 E ALKKYNMGD+KTIKEI+AEVD+DNDG+INY+EFVAMM+KGNPD+ NRR K Sbjct: 457 ESALKKYNMGDEKTIKEIIAEVDSDNDGRINYEEFVAMMRKGNPDLVTNRRSK 509 >gb|AHN16201.1| CPK3-2.1 [Brassica napus] Length = 527 Score = 92.0 bits (227), Expect = 8e-17 Identities = 42/52 (80%), Positives = 49/52 (94%) Frame = -3 Query: 459 EQALKKYNMGDDKTIKEILAEVDTDNDGKINYDEFVAMMKKGNPDIGGNRRR 304 EQA+KKYNMGDDK+IKEI+AEVDTD DGKINY+EFVAMMKKG+P++ NRRR Sbjct: 473 EQAMKKYNMGDDKSIKEIIAEVDTDRDGKINYEEFVAMMKKGHPELVTNRRR 524 >gb|AGG35973.1| calcium-dependent protein kinase 3, partial [Brassica napus] Length = 525 Score = 92.0 bits (227), Expect = 8e-17 Identities = 42/52 (80%), Positives = 49/52 (94%) Frame = -3 Query: 459 EQALKKYNMGDDKTIKEILAEVDTDNDGKINYDEFVAMMKKGNPDIGGNRRR 304 EQA+KKYNMGDDK+IKEI+AEVDTD DGKINY+EFVAMMKKG+P++ NRRR Sbjct: 471 EQAMKKYNMGDDKSIKEIIAEVDTDRDGKINYEEFVAMMKKGHPELVTNRRR 522 >ref|XP_004298849.1| PREDICTED: calcium-dependent protein kinase 3-like [Fragaria vesca subsp. vesca] Length = 519 Score = 91.7 bits (226), Expect = 1e-16 Identities = 42/53 (79%), Positives = 49/53 (92%) Frame = -3 Query: 459 EQALKKYNMGDDKTIKEILAEVDTDNDGKINYDEFVAMMKKGNPDIGGNRRRK 301 EQALKKYNMGD++TIKEI+ EVDTD DG+INYDEFVAMM+KGNP++ NRRRK Sbjct: 467 EQALKKYNMGDEQTIKEIITEVDTDLDGRINYDEFVAMMRKGNPELVTNRRRK 519 >ref|XP_003525360.1| PREDICTED: calcium-dependent protein kinase 3-like isoform 1 [Glycine max] Length = 518 Score = 91.7 bits (226), Expect = 1e-16 Identities = 45/55 (81%), Positives = 49/55 (89%), Gaps = 2/55 (3%) Frame = -3 Query: 459 EQALKKYNMGDDKTIKEILAEVDTDNDGKINYDEFVAMMKKGNPDIG--GNRRRK 301 E ALKKYNMGD+KTIKEI+AEVDTDNDG+INYDEFVAMM+KGNPDI RRRK Sbjct: 464 ESALKKYNMGDEKTIKEIIAEVDTDNDGRINYDEFVAMMRKGNPDITHITQRRRK 518 >gb|AGS15000.1| calcium-dependent protein kinase 3 [Vitis amurensis] Length = 528 Score = 91.3 bits (225), Expect = 1e-16 Identities = 41/53 (77%), Positives = 49/53 (92%) Frame = -3 Query: 459 EQALKKYNMGDDKTIKEILAEVDTDNDGKINYDEFVAMMKKGNPDIGGNRRRK 301 E ALK+YNMGD+KTIKEI+AEVDTD+DG+INY+EF AMM+KGNPD+ NRRRK Sbjct: 476 EHALKRYNMGDEKTIKEIIAEVDTDHDGRINYEEFAAMMRKGNPDLITNRRRK 528 >ref|XP_004503656.1| PREDICTED: calcium-dependent protein kinase 3-like [Cicer arietinum] Length = 511 Score = 91.3 bits (225), Expect = 1e-16 Identities = 42/52 (80%), Positives = 47/52 (90%) Frame = -3 Query: 459 EQALKKYNMGDDKTIKEILAEVDTDNDGKINYDEFVAMMKKGNPDIGGNRRR 304 E ALKKYNMGD+KTIKEI+AEVDTDND +INYDEFVAMM+KGNPDI RR+ Sbjct: 460 ESALKKYNMGDEKTIKEIIAEVDTDNDARINYDEFVAMMRKGNPDITKRRRK 511 >ref|XP_002867697.1| calcium-dependent protein kinase 6 [Arabidopsis lyrata subsp. lyrata] gi|297313533|gb|EFH43956.1| calcium-dependent protein kinase 6 [Arabidopsis lyrata subsp. lyrata] Length = 519 Score = 91.3 bits (225), Expect = 1e-16 Identities = 42/52 (80%), Positives = 48/52 (92%) Frame = -3 Query: 459 EQALKKYNMGDDKTIKEILAEVDTDNDGKINYDEFVAMMKKGNPDIGGNRRR 304 E A+KKYNMGDDK+IKEI+AEVDTD DGKINY+EFVAMMKKGNP++ NRRR Sbjct: 467 ELAMKKYNMGDDKSIKEIIAEVDTDRDGKINYEEFVAMMKKGNPELVPNRRR 518 >emb|CBI34415.3| unnamed protein product [Vitis vinifera] Length = 399 Score = 91.3 bits (225), Expect = 1e-16 Identities = 41/53 (77%), Positives = 49/53 (92%) Frame = -3 Query: 459 EQALKKYNMGDDKTIKEILAEVDTDNDGKINYDEFVAMMKKGNPDIGGNRRRK 301 E ALK+YNMGD+KTIKEI+AEVDTD+DG+INY+EF AMM+KGNPD+ NRRRK Sbjct: 347 EHALKRYNMGDEKTIKEIIAEVDTDHDGRINYEEFAAMMRKGNPDLITNRRRK 399 >ref|XP_002272270.1| PREDICTED: calcium-dependent protein kinase 3 [Vitis vinifera] Length = 528 Score = 91.3 bits (225), Expect = 1e-16 Identities = 41/53 (77%), Positives = 49/53 (92%) Frame = -3 Query: 459 EQALKKYNMGDDKTIKEILAEVDTDNDGKINYDEFVAMMKKGNPDIGGNRRRK 301 E ALK+YNMGD+KTIKEI+AEVDTD+DG+INY+EF AMM+KGNPD+ NRRRK Sbjct: 476 EHALKRYNMGDEKTIKEIIAEVDTDHDGRINYEEFAAMMRKGNPDLITNRRRK 528 >emb|CAN61364.1| hypothetical protein VITISV_032639 [Vitis vinifera] Length = 482 Score = 91.3 bits (225), Expect = 1e-16 Identities = 41/53 (77%), Positives = 49/53 (92%) Frame = -3 Query: 459 EQALKKYNMGDDKTIKEILAEVDTDNDGKINYDEFVAMMKKGNPDIGGNRRRK 301 E ALK+YNMGD+KTIKEI+AEVDTD+DG+INY+EF AMM+KGNPD+ NRRRK Sbjct: 430 EHALKRYNMGDEKTIKEIIAEVDTDHDGRINYEEFAAMMRKGNPDLITNRRRK 482 >ref|NP_194096.1| calcium-dependent protein kinase 6 [Arabidopsis thaliana] gi|75319675|sp|Q42479.1|CDPK3_ARATH RecName: Full=Calcium-dependent protein kinase 3; AltName: Full=Calcium-dependent protein kinase isoform CDPK6; Short=AtCDPK6 gi|14326514|gb|AAK60302.1|AF385710_1 AT4g23650/F9D16_120 [Arabidopsis thaliana] gi|836940|gb|AAA67654.1| calcium-dependent protein kinase [Arabidopsis thaliana] gi|836944|gb|AAA67656.1| calcium-dependent protein kinase [Arabidopsis thaliana] gi|4454034|emb|CAA23031.1| calcium-dependent protein kinase (CDPK6) [Arabidopsis thaliana] gi|7269213|emb|CAB79320.1| calcium-dependent protein kinase (CDPK6) [Arabidopsis thaliana] gi|19548043|gb|AAL87385.1| AT4g23650/F9D16_120 [Arabidopsis thaliana] gi|21593227|gb|AAM65176.1| calcium-dependent protein kinase CDPK6 [Arabidopsis thaliana] gi|23397190|gb|AAN31878.1| putative calcium-dependent protein kinase (CDPK6) [Arabidopsis thaliana] gi|332659389|gb|AEE84789.1| calcium-dependent protein kinase 6 [Arabidopsis thaliana] Length = 529 Score = 91.3 bits (225), Expect = 1e-16 Identities = 42/52 (80%), Positives = 48/52 (92%) Frame = -3 Query: 459 EQALKKYNMGDDKTIKEILAEVDTDNDGKINYDEFVAMMKKGNPDIGGNRRR 304 E A+KKYNMGDDK+IKEI+AEVDTD DGKINY+EFVAMMKKGNP++ NRRR Sbjct: 477 ELAMKKYNMGDDKSIKEIIAEVDTDRDGKINYEEFVAMMKKGNPELVPNRRR 528