BLASTX nr result
ID: Mentha26_contig00014510
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00014510 (502 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU36693.1| hypothetical protein MIMGU_mgv1a014878mg [Mimulus... 61 1e-07 >gb|EYU36693.1| hypothetical protein MIMGU_mgv1a014878mg [Mimulus guttatus] Length = 175 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/36 (77%), Positives = 32/36 (88%) Frame = -3 Query: 110 LNRRKMMQHKRDPISLEQSSFMDIMPKRLKTDEPLS 3 + RR+MMQHKR PISLEQ+SF D+MPKRLKTD PLS Sbjct: 22 MERREMMQHKRGPISLEQNSFTDLMPKRLKTDVPLS 57