BLASTX nr result
ID: Mentha26_contig00014432
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00014432 (341 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002512607.1| hypothetical protein RCOM_1437240 [Ricinus c... 62 6e-08 >ref|XP_002512607.1| hypothetical protein RCOM_1437240 [Ricinus communis] gi|223548568|gb|EEF50059.1| hypothetical protein RCOM_1437240 [Ricinus communis] Length = 930 Score = 62.4 bits (150), Expect = 6e-08 Identities = 43/118 (36%), Positives = 57/118 (48%), Gaps = 19/118 (16%) Frame = -1 Query: 317 KGCLPQWLRAA---------ARIPASVGPMWHNHPSQQPW-------LNNQFISTERRPE 186 KG LP WLR A A +P + + H+ + P+ N + R E Sbjct: 813 KGNLPHWLREAVYTPPRPMDATLPPAFSSIAHSGTKRVPYPDPSELHFNGSELGRVRVSE 872 Query: 185 AENGRKGPSSGSLLVVEHGRTGLDE---EPVSKQEDLIIIPSDASSEETISDDHSGRP 21 + + L V HG+T + PV+K ++LIII SDASSEETISDDHS RP Sbjct: 873 LKPSYGAHRTNGSLGVRHGKTEVSRVSMRPVNKPDNLIIIDSDASSEETISDDHSARP 930