BLASTX nr result
ID: Mentha26_contig00014428
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00014428 (525 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU25785.1| hypothetical protein MIMGU_mgv1a011134mg [Mimulus... 70 3e-10 >gb|EYU25785.1| hypothetical protein MIMGU_mgv1a011134mg [Mimulus guttatus] Length = 291 Score = 70.1 bits (170), Expect = 3e-10 Identities = 36/56 (64%), Positives = 48/56 (85%), Gaps = 2/56 (3%) Frame = +2 Query: 362 MERKRPSQGCSVVGVIKKIACLEGSSPDTGKGKS--KSSTITNQVSHGFNLVKGQS 523 ME+K QG SV+G+IKK+AC++GSSPD+GKGKS KSS+ TN+V HGF+LV+G+S Sbjct: 1 MEKK---QGFSVLGMIKKVACIDGSSPDSGKGKSEYKSSSNTNKVCHGFHLVEGKS 53