BLASTX nr result
ID: Mentha26_contig00014292
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00014292 (331 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU26663.1| hypothetical protein MIMGU_mgv1a006044mg [Mimulus... 55 8e-06 >gb|EYU26663.1| hypothetical protein MIMGU_mgv1a006044mg [Mimulus guttatus] Length = 460 Score = 55.5 bits (132), Expect = 8e-06 Identities = 34/74 (45%), Positives = 41/74 (55%), Gaps = 2/74 (2%) Frame = +3 Query: 114 KQDNGKMAAAMAPDQQWLLENGNIKLLSKERR--GRSAHNMXXXXXXXXXXXXXXXXXXI 287 ++D+GKMA Q+ LENGNIKLLS+E R R+AHNM + Sbjct: 4 RRDSGKMATTTT-QQEAFLENGNIKLLSREMRHGSRTAHNMSSSSLRKKSDRALVSKIRV 62 Query: 288 GCLRKFLTNLQEVL 329 G LR F TNLQEVL Sbjct: 63 GFLRMFFTNLQEVL 76