BLASTX nr result
ID: Mentha26_contig00014281
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00014281 (353 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU28891.1| hypothetical protein MIMGU_mgv1a008279mg [Mimulus... 79 9e-13 gb|EPS63066.1| hypothetical protein M569_11719 [Genlisea aurea] 71 1e-10 gb|AGW24467.1| hypothetical protein, partial [Avicennia marina v... 68 2e-09 >gb|EYU28891.1| hypothetical protein MIMGU_mgv1a008279mg [Mimulus guttatus] Length = 379 Score = 78.6 bits (192), Expect = 9e-13 Identities = 40/53 (75%), Positives = 43/53 (81%) Frame = -3 Query: 348 LSCSNSRRVSPFLKLLMPPSRVGPGSQPGMARRALAGLIDARSAVVATTNVAI 190 LSCS+ RR SPFLKLLMPPS VGPG PG+ R A AGLIDA SAVVATT+V I Sbjct: 25 LSCSSRRRESPFLKLLMPPSMVGPGCHPGIDRSAFAGLIDAGSAVVATTSVTI 77 >gb|EPS63066.1| hypothetical protein M569_11719 [Genlisea aurea] Length = 328 Score = 71.2 bits (173), Expect = 1e-10 Identities = 32/40 (80%), Positives = 36/40 (90%) Frame = +2 Query: 230 SINPARALLAMPGWLPGPTLDGGIRSFKNGDTLRLLEQDR 349 SINPA+ALLA PGW PGP LDGGIRSFK GD++RLLEQD+ Sbjct: 27 SINPAKALLAKPGWAPGPILDGGIRSFKYGDSVRLLEQDK 66 >gb|AGW24467.1| hypothetical protein, partial [Avicennia marina var. marina] Length = 97 Score = 67.8 bits (164), Expect = 2e-09 Identities = 32/40 (80%), Positives = 34/40 (85%) Frame = +2 Query: 230 SINPARALLAMPGWLPGPTLDGGIRSFKNGDTLRLLEQDR 349 SINPA ALLAMPGW GPTLD IRSFKNGD+LRLLE D+ Sbjct: 15 SINPAHALLAMPGWHQGPTLDTDIRSFKNGDSLRLLEHDK 54