BLASTX nr result
ID: Mentha26_contig00013872
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00013872 (343 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU19770.1| hypothetical protein MIMGU_mgv1a027135mg [Mimulus... 58 1e-06 >gb|EYU19770.1| hypothetical protein MIMGU_mgv1a027135mg [Mimulus guttatus] Length = 564 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = -1 Query: 94 MVTQSWFRSLWTTSKKNEFHTEKAKIAVLAF 2 MV+QSWFR+LWT SKKNEFH EK++IAVLAF Sbjct: 1 MVSQSWFRNLWTNSKKNEFHVEKSQIAVLAF 31