BLASTX nr result
ID: Mentha26_contig00013603
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00013603 (1013 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFK40691.1| unknown [Lotus japonicus] 65 3e-08 dbj|BAB11239.1| RAR1 [Arabidopsis thaliana] 65 6e-08 gb|AFK47530.1| unknown [Medicago truncatula] 65 6e-08 gb|ACJ86102.1| unknown [Medicago truncatula] 65 6e-08 ref|XP_003592395.1| Cysteine and histidine-rich domain-containin... 65 6e-08 gb|AFW71696.1| integrin beta-1-binding protein 2 [Zea mays] 64 8e-08 gb|ACX68653.1| RAR1 [Saccharum hybrid cultivar] 64 8e-08 ref|XP_006374653.1| hypothetical protein POPTR_0015s14260g [Popu... 64 1e-07 ref|XP_007038490.1| Binding,zinc ion binding isoform 1 [Theobrom... 64 1e-07 ref|XP_004496652.1| PREDICTED: cysteine and histidine-rich domai... 64 1e-07 ref|XP_004159991.1| PREDICTED: LOW QUALITY PROTEIN: cysteine and... 64 1e-07 ref|XP_004138923.1| PREDICTED: cysteine and histidine-rich domai... 64 1e-07 ref|XP_002322427.1| PPHB SUSCEPTIBLE 2 family protein [Populus t... 64 1e-07 gb|ABK94029.1| unknown [Populus trichocarpa] 64 1e-07 gb|EYU25016.1| hypothetical protein MIMGU_mgv1a013468mg [Mimulus... 63 2e-07 ref|XP_006421770.1| hypothetical protein CICLE_v10005807mg [Citr... 63 2e-07 ref|XP_006421769.1| hypothetical protein CICLE_v10005807mg [Citr... 63 2e-07 emb|CBI24497.3| unnamed protein product [Vitis vinifera] 63 2e-07 ref|XP_002269178.1| PREDICTED: cysteine and histidine-rich domai... 63 2e-07 ref|XP_006401921.1| hypothetical protein EUTSA_v10014608mg [Eutr... 62 3e-07 >gb|AFK40691.1| unknown [Lotus japonicus] Length = 224 Score = 65.5 bits (158), Expect = 3e-08 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = -3 Query: 345 PKFHDGMKEWSCCKKRSHDFSLFLQIPG 262 P FHDGMKEWSCCKKRSHDFSLFLQIPG Sbjct: 35 PLFHDGMKEWSCCKKRSHDFSLFLQIPG 62 >dbj|BAB11239.1| RAR1 [Arabidopsis thaliana] Length = 226 Score = 64.7 bits (156), Expect = 6e-08 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = -3 Query: 360 FALFQPKFHDGMKEWSCCKKRSHDFSLFLQIPG 262 F QP FHDGMKEWSCCK+RSHDFSLFL+IPG Sbjct: 33 FHASQPFFHDGMKEWSCCKQRSHDFSLFLEIPG 65 >gb|AFK47530.1| unknown [Medicago truncatula] Length = 225 Score = 64.7 bits (156), Expect = 6e-08 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = -3 Query: 345 PKFHDGMKEWSCCKKRSHDFSLFLQIPG 262 P FHDGMKEWSCCKKRSHDFSLFL+IPG Sbjct: 36 PTFHDGMKEWSCCKKRSHDFSLFLEIPG 63 >gb|ACJ86102.1| unknown [Medicago truncatula] Length = 191 Score = 64.7 bits (156), Expect = 6e-08 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = -3 Query: 345 PKFHDGMKEWSCCKKRSHDFSLFLQIPG 262 P FHDGMKEWSCCKKRSHDFSLFL+IPG Sbjct: 36 PTFHDGMKEWSCCKKRSHDFSLFLEIPG 63 >ref|XP_003592395.1| Cysteine and histidine-rich domain-containing protein [Medicago truncatula] gi|355481443|gb|AES62646.1| Cysteine and histidine-rich domain-containing protein [Medicago truncatula] Length = 224 Score = 64.7 bits (156), Expect = 6e-08 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = -3 Query: 345 PKFHDGMKEWSCCKKRSHDFSLFLQIPG 262 P FHDGMKEWSCCKKRSHDFSLFL+IPG Sbjct: 35 PTFHDGMKEWSCCKKRSHDFSLFLEIPG 62 >gb|AFW71696.1| integrin beta-1-binding protein 2 [Zea mays] Length = 225 Score = 64.3 bits (155), Expect = 8e-08 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = -3 Query: 345 PKFHDGMKEWSCCKKRSHDFSLFLQIPG 262 P FHDGMKEWSCCK+RSHDFSLFLQIPG Sbjct: 44 PMFHDGMKEWSCCKQRSHDFSLFLQIPG 71 >gb|ACX68653.1| RAR1 [Saccharum hybrid cultivar] Length = 225 Score = 64.3 bits (155), Expect = 8e-08 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = -3 Query: 345 PKFHDGMKEWSCCKKRSHDFSLFLQIPG 262 P FHDGMKEWSCCK+RSHDFSLFLQIPG Sbjct: 44 PMFHDGMKEWSCCKQRSHDFSLFLQIPG 71 >ref|XP_006374653.1| hypothetical protein POPTR_0015s14260g [Populus trichocarpa] gi|550322698|gb|ERP52450.1| hypothetical protein POPTR_0015s14260g [Populus trichocarpa] Length = 215 Score = 63.9 bits (154), Expect = 1e-07 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = -3 Query: 345 PKFHDGMKEWSCCKKRSHDFSLFLQIPG 262 P FHDGMKEWSCCKKRSHDFSLFL+IPG Sbjct: 37 PFFHDGMKEWSCCKKRSHDFSLFLEIPG 64 >ref|XP_007038490.1| Binding,zinc ion binding isoform 1 [Theobroma cacao] gi|508775735|gb|EOY22991.1| Binding,zinc ion binding isoform 1 [Theobroma cacao] Length = 219 Score = 63.9 bits (154), Expect = 1e-07 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = -3 Query: 345 PKFHDGMKEWSCCKKRSHDFSLFLQIPG 262 P FHDGMKEWSCCKKRSHDFSLFL+IPG Sbjct: 35 PIFHDGMKEWSCCKKRSHDFSLFLEIPG 62 >ref|XP_004496652.1| PREDICTED: cysteine and histidine-rich domain-containing protein RAR1-like [Cicer arietinum] Length = 215 Score = 63.9 bits (154), Expect = 1e-07 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = -3 Query: 345 PKFHDGMKEWSCCKKRSHDFSLFLQIPG 262 P FHDGMKEWSCCKKRSHDFSLFL+IPG Sbjct: 36 PIFHDGMKEWSCCKKRSHDFSLFLEIPG 63 >ref|XP_004159991.1| PREDICTED: LOW QUALITY PROTEIN: cysteine and histidine-rich domain-containing protein RAR1-like [Cucumis sativus] Length = 219 Score = 63.9 bits (154), Expect = 1e-07 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = -3 Query: 345 PKFHDGMKEWSCCKKRSHDFSLFLQIPG 262 P FHDGMKEWSCCKKRSHDFSLFL+IPG Sbjct: 36 PIFHDGMKEWSCCKKRSHDFSLFLEIPG 63 >ref|XP_004138923.1| PREDICTED: cysteine and histidine-rich domain-containing protein RAR1-like [Cucumis sativus] Length = 219 Score = 63.9 bits (154), Expect = 1e-07 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = -3 Query: 345 PKFHDGMKEWSCCKKRSHDFSLFLQIPG 262 P FHDGMKEWSCCKKRSHDFSLFL+IPG Sbjct: 36 PIFHDGMKEWSCCKKRSHDFSLFLEIPG 63 >ref|XP_002322427.1| PPHB SUSCEPTIBLE 2 family protein [Populus trichocarpa] gi|222869423|gb|EEF06554.1| PPHB SUSCEPTIBLE 2 family protein [Populus trichocarpa] Length = 204 Score = 63.9 bits (154), Expect = 1e-07 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = -3 Query: 345 PKFHDGMKEWSCCKKRSHDFSLFLQIPG 262 P FHDGMKEWSCCKKRSHDFSLFL+IPG Sbjct: 36 PFFHDGMKEWSCCKKRSHDFSLFLEIPG 63 >gb|ABK94029.1| unknown [Populus trichocarpa] Length = 215 Score = 63.9 bits (154), Expect = 1e-07 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = -3 Query: 345 PKFHDGMKEWSCCKKRSHDFSLFLQIPG 262 P FHDGMKEWSCCKKRSHDFSLFL+IPG Sbjct: 37 PFFHDGMKEWSCCKKRSHDFSLFLEIPG 64 >gb|EYU25016.1| hypothetical protein MIMGU_mgv1a013468mg [Mimulus guttatus] gi|604305960|gb|EYU25017.1| hypothetical protein MIMGU_mgv1a013468mg [Mimulus guttatus] Length = 219 Score = 62.8 bits (151), Expect = 2e-07 Identities = 24/28 (85%), Positives = 27/28 (96%) Frame = -3 Query: 345 PKFHDGMKEWSCCKKRSHDFSLFLQIPG 262 P+FHDGMKEWSCCK+RSHDFSLF+ IPG Sbjct: 31 PRFHDGMKEWSCCKQRSHDFSLFMDIPG 58 >ref|XP_006421770.1| hypothetical protein CICLE_v10005807mg [Citrus clementina] gi|568874318|ref|XP_006490263.1| PREDICTED: cysteine and histidine-rich domain-containing protein RAR1-like [Citrus sinensis] gi|557523643|gb|ESR35010.1| hypothetical protein CICLE_v10005807mg [Citrus clementina] Length = 228 Score = 62.8 bits (151), Expect = 2e-07 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = -3 Query: 345 PKFHDGMKEWSCCKKRSHDFSLFLQIPG 262 P FHDGMKEWSCCK+RSHDFSLFL+IPG Sbjct: 40 PIFHDGMKEWSCCKRRSHDFSLFLEIPG 67 >ref|XP_006421769.1| hypothetical protein CICLE_v10005807mg [Citrus clementina] gi|557523642|gb|ESR35009.1| hypothetical protein CICLE_v10005807mg [Citrus clementina] Length = 227 Score = 62.8 bits (151), Expect = 2e-07 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = -3 Query: 345 PKFHDGMKEWSCCKKRSHDFSLFLQIPG 262 P FHDGMKEWSCCK+RSHDFSLFL+IPG Sbjct: 39 PIFHDGMKEWSCCKRRSHDFSLFLEIPG 66 >emb|CBI24497.3| unnamed protein product [Vitis vinifera] Length = 200 Score = 62.8 bits (151), Expect = 2e-07 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 345 PKFHDGMKEWSCCKKRSHDFSLFLQIPG 262 P FHDGMKEWSCCKKRSHDFSLFL IPG Sbjct: 17 PFFHDGMKEWSCCKKRSHDFSLFLAIPG 44 >ref|XP_002269178.1| PREDICTED: cysteine and histidine-rich domain-containing protein RAR1-like [Vitis vinifera] Length = 219 Score = 62.8 bits (151), Expect = 2e-07 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 345 PKFHDGMKEWSCCKKRSHDFSLFLQIPG 262 P FHDGMKEWSCCKKRSHDFSLFL IPG Sbjct: 36 PFFHDGMKEWSCCKKRSHDFSLFLAIPG 63 >ref|XP_006401921.1| hypothetical protein EUTSA_v10014608mg [Eutrema salsugineum] gi|557103011|gb|ESQ43374.1| hypothetical protein EUTSA_v10014608mg [Eutrema salsugineum] Length = 223 Score = 62.4 bits (150), Expect = 3e-07 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = -3 Query: 345 PKFHDGMKEWSCCKKRSHDFSLFLQIPG 262 P FHDGMKEWSCCK+RSHDFSLFL+IPG Sbjct: 38 PFFHDGMKEWSCCKQRSHDFSLFLEIPG 65