BLASTX nr result
ID: Mentha26_contig00013570
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00013570 (489 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value tpg|DAA00278.1| TPA_exp: putative phytosulfokine peptide precurs... 60 3e-07 gb|EYU37556.1| hypothetical protein MIMGU_mgv1a020195mg [Mimulus... 59 7e-07 ref|XP_006346282.1| PREDICTED: phytosulfokines-like [Solanum tub... 58 1e-06 ref|XP_004230682.1| PREDICTED: phytosulfokines 5-like [Solanum l... 58 1e-06 ref|XP_007047591.1| Phytosulfokines 3 precursor, putative [Theob... 55 8e-06 >tpg|DAA00278.1| TPA_exp: putative phytosulfokine peptide precursor [Gossypium arboreum] Length = 84 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -3 Query: 484 KDRCSGEGEDECLVRRTLEAHLDYIYTQKQK 392 +DRC G GEDECL+RRTL AHLDYIYTQKQK Sbjct: 53 EDRCEGVGEDECLMRRTLAAHLDYIYTQKQK 83 >gb|EYU37556.1| hypothetical protein MIMGU_mgv1a020195mg [Mimulus guttatus] Length = 84 Score = 58.9 bits (141), Expect = 7e-07 Identities = 24/33 (72%), Positives = 30/33 (90%) Frame = -3 Query: 487 EKDRCSGEGEDECLVRRTLEAHLDYIYTQKQKQ 389 ++DRC G GEDECL+RRTL+AH+DYIYT K+KQ Sbjct: 49 DRDRCVGLGEDECLMRRTLDAHIDYIYTHKRKQ 81 >ref|XP_006346282.1| PREDICTED: phytosulfokines-like [Solanum tuberosum] Length = 83 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/34 (76%), Positives = 30/34 (88%), Gaps = 1/34 (2%) Frame = -3 Query: 484 KDRCSGEG-EDECLVRRTLEAHLDYIYTQKQKQP 386 +DRC G G E+ECL+RRTLEAHLDYIYTQ+ KQP Sbjct: 50 EDRCEGPGGEEECLMRRTLEAHLDYIYTQRHKQP 83 >ref|XP_004230682.1| PREDICTED: phytosulfokines 5-like [Solanum lycopersicum] Length = 83 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/34 (76%), Positives = 30/34 (88%), Gaps = 1/34 (2%) Frame = -3 Query: 484 KDRCSGEG-EDECLVRRTLEAHLDYIYTQKQKQP 386 +DRC G G E+ECL+RRTLEAHLDYIYTQ+ KQP Sbjct: 50 EDRCEGPGGEEECLMRRTLEAHLDYIYTQRHKQP 83 >ref|XP_007047591.1| Phytosulfokines 3 precursor, putative [Theobroma cacao] gi|508699852|gb|EOX91748.1| Phytosulfokines 3 precursor, putative [Theobroma cacao] Length = 81 Score = 55.5 bits (132), Expect = 8e-06 Identities = 23/31 (74%), Positives = 27/31 (87%) Frame = -3 Query: 484 KDRCSGEGEDECLVRRTLEAHLDYIYTQKQK 392 +D C G GE+ECL+RRTL AH+DYIYTQKQK Sbjct: 50 EDSCEGVGEEECLMRRTLAAHIDYIYTQKQK 80