BLASTX nr result
ID: Mentha26_contig00013521
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00013521 (517 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003550154.1| PREDICTED: histone H4-like [Glycine max] 37 9e-06 >ref|XP_003550154.1| PREDICTED: histone H4-like [Glycine max] Length = 103 Score = 37.4 bits (85), Expect(3) = 9e-06 Identities = 20/31 (64%), Positives = 21/31 (67%) Frame = +1 Query: 232 KSAICRLARHSSAKFINRLIYEETRDALMIF 324 K AI RLAR K I+ LIYEETR LMIF Sbjct: 32 KPAIRRLARRGGVKRISGLIYEETRGVLMIF 62 Score = 32.7 bits (73), Expect(3) = 9e-06 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = +3 Query: 321 LCDAVTYTKHGHEKSATVMDV 383 +CD VTYT+H K+ T MDV Sbjct: 67 ICDVVTYTEHARRKTVTAMDV 87 Score = 24.3 bits (51), Expect(3) = 9e-06 Identities = 13/25 (52%), Positives = 14/25 (56%) Frame = +2 Query: 356 RKICHRHGCLYALKRQRCFLCGFGG 430 RK +YALKRQ L GFGG Sbjct: 79 RKTVTAMDVVYALKRQGRTLYGFGG 103