BLASTX nr result
ID: Mentha26_contig00013491
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00013491 (321 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU25877.1| hypothetical protein MIMGU_mgv1a0032851mg, partia... 63 4e-08 >gb|EYU25877.1| hypothetical protein MIMGU_mgv1a0032851mg, partial [Mimulus guttatus] Length = 504 Score = 63.2 bits (152), Expect = 4e-08 Identities = 31/53 (58%), Positives = 39/53 (73%), Gaps = 1/53 (1%) Frame = +2 Query: 164 YNTDNLKPQAVKRGKKVKAMFVCEWLAFVSITTLLILSKTINKLE-ETEIWSV 319 YNT+N+K VKRGKKVKA+ V EW+ F+SIT LLI S T+ KL+ T IW + Sbjct: 16 YNTENIKLDKVKRGKKVKALVVIEWIVFISITALLISSLTVGKLKNHTLIWGL 68