BLASTX nr result
ID: Mentha26_contig00013435
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00013435 (447 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU45552.1| hypothetical protein MIMGU_mgv1a012367mg [Mimulus... 133 2e-29 gb|EPS64543.1| hypothetical protein M569_10238 [Genlisea aurea] 122 7e-26 ref|XP_006419586.1| hypothetical protein CICLE_v10005679mg [Citr... 115 8e-24 ref|XP_006489092.1| PREDICTED: alanine--tRNA ligase, mitochondri... 112 5e-23 ref|XP_002314450.2| alanyl-tRNA synthetase-related family protei... 112 5e-23 ref|NP_683570.3| threonyl and alanyl tRNA synthetase second addi... 112 5e-23 ref|NP_001078163.1| threonyl and alanyl tRNA synthetase second a... 112 5e-23 ref|XP_006298642.1| hypothetical protein CARUB_v10014731mg [Caps... 112 7e-23 ref|XP_006406826.1| hypothetical protein EUTSA_v10021369mg [Eutr... 111 9e-23 ref|XP_006840500.1| hypothetical protein AMTR_s00045p00197400 [A... 111 9e-23 ref|XP_003609668.1| Alanyl-tRNA synthetase [Medicago truncatula]... 111 1e-22 gb|ACJ84608.1| unknown [Medicago truncatula] gi|388493132|gb|AFK... 111 1e-22 ref|XP_007035578.1| Alanine-tRNA ligases,nucleic acid binding,li... 110 2e-22 ref|XP_007035576.1| Alanine-tRNA ligases,nucleic acid binding,li... 110 2e-22 ref|XP_007035575.1| Alanine-tRNA ligases,nucleic acid binding,li... 110 2e-22 ref|XP_007035574.1| Alanine-tRNA ligases,nucleic acid binding,li... 110 2e-22 ref|XP_002885151.1| ATP binding protein [Arabidopsis lyrata subs... 110 2e-22 gb|EYU45553.1| hypothetical protein MIMGU_mgv1a012367mg [Mimulus... 109 3e-22 ref|XP_002273600.1| PREDICTED: alanyl-tRNA editing protein AlaX-... 109 3e-22 emb|CBI26074.3| unnamed protein product [Vitis vinifera] 109 3e-22 >gb|EYU45552.1| hypothetical protein MIMGU_mgv1a012367mg [Mimulus guttatus] Length = 252 Score = 133 bits (335), Expect = 2e-29 Identities = 64/81 (79%), Positives = 70/81 (86%) Frame = -2 Query: 245 GYRVLCRPYVEYKGAVPQNELQSKQNELQAEASNLITKGGKVSVSILPYDKASELCGGSL 66 GY P+VEYKG VPQNEL SK+ EL+ EASNLI+KGGKVS+SI+PYDKASELCGGSL Sbjct: 137 GYHFQDGPFVEYKGVVPQNELHSKKTELELEASNLISKGGKVSISIVPYDKASELCGGSL 196 Query: 65 PDYIPKDSTPRIVQLGETLGC 3 PDYIPKDSTPRIVQLGE GC Sbjct: 197 PDYIPKDSTPRIVQLGEFPGC 217 >gb|EPS64543.1| hypothetical protein M569_10238 [Genlisea aurea] Length = 254 Score = 122 bits (305), Expect = 7e-26 Identities = 59/81 (72%), Positives = 66/81 (81%) Frame = -2 Query: 245 GYRVLCRPYVEYKGAVPQNELQSKQNELQAEASNLITKGGKVSVSILPYDKASELCGGSL 66 GY PYVEYKGAVPQNELQ KQ EL+ EASNLI+KGGK+SVSI+ YD AS+LC +L Sbjct: 139 GYHFADGPYVEYKGAVPQNELQIKQKELEIEASNLISKGGKISVSIVSYDLASQLCRATL 198 Query: 65 PDYIPKDSTPRIVQLGETLGC 3 PDYIPKDS PRIVQ+GE GC Sbjct: 199 PDYIPKDSNPRIVQIGEYPGC 219 >ref|XP_006419586.1| hypothetical protein CICLE_v10005679mg [Citrus clementina] gi|557521459|gb|ESR32826.1| hypothetical protein CICLE_v10005679mg [Citrus clementina] Length = 258 Score = 115 bits (287), Expect = 8e-24 Identities = 54/81 (66%), Positives = 66/81 (81%) Frame = -2 Query: 245 GYRVLCRPYVEYKGAVPQNELQSKQNELQAEASNLITKGGKVSVSILPYDKASELCGGSL 66 GY PYVEYKG+VPQNELQSK EL+ EA+ LI++GGKV V++LPY++AS LCGG L Sbjct: 142 GYHFPDGPYVEYKGSVPQNELQSKTKELELEANALISRGGKVMVAVLPYEEASMLCGGCL 201 Query: 65 PDYIPKDSTPRIVQLGETLGC 3 PDYIP+ STPRIV+LG+ GC Sbjct: 202 PDYIPQGSTPRIVKLGDNPGC 222 >ref|XP_006489092.1| PREDICTED: alanine--tRNA ligase, mitochondrial-like [Citrus sinensis] Length = 258 Score = 112 bits (280), Expect = 5e-23 Identities = 53/81 (65%), Positives = 65/81 (80%) Frame = -2 Query: 245 GYRVLCRPYVEYKGAVPQNELQSKQNELQAEASNLITKGGKVSVSILPYDKASELCGGSL 66 GY PYVEYKG+VPQNELQSK EL+ EA+ LI++GGKV V++LPY++AS LCGG L Sbjct: 142 GYHFPDGPYVEYKGSVPQNELQSKTKELELEANALISRGGKVMVAVLPYEEASMLCGGCL 201 Query: 65 PDYIPKDSTPRIVQLGETLGC 3 P YIP+ STPRIV+LG+ GC Sbjct: 202 PHYIPQGSTPRIVKLGDNPGC 222 >ref|XP_002314450.2| alanyl-tRNA synthetase-related family protein [Populus trichocarpa] gi|550328951|gb|EEF00621.2| alanyl-tRNA synthetase-related family protein [Populus trichocarpa] Length = 246 Score = 112 bits (280), Expect = 5e-23 Identities = 51/81 (62%), Positives = 66/81 (81%) Frame = -2 Query: 245 GYRVLCRPYVEYKGAVPQNELQSKQNELQAEASNLITKGGKVSVSILPYDKASELCGGSL 66 GY P+VEYKG +PQNELQSKQ+EL+ A+ LI++GGKVS ++LPY++A+ELCGG L Sbjct: 142 GYHFPDGPFVEYKGTIPQNELQSKQHELELAANALISRGGKVSAAVLPYEEAAELCGGFL 201 Query: 65 PDYIPKDSTPRIVQLGETLGC 3 PDYIPKDSTPR+V+L + C Sbjct: 202 PDYIPKDSTPRVVKLRNSAVC 222 >ref|NP_683570.3| threonyl and alanyl tRNA synthetase second additional domain-containing protein [Arabidopsis thaliana] gi|332642316|gb|AEE75837.1| threonyl and alanyl tRNA synthetase second additional domain-containing protein [Arabidopsis thaliana] Length = 253 Score = 112 bits (280), Expect = 5e-23 Identities = 53/81 (65%), Positives = 65/81 (80%) Frame = -2 Query: 245 GYRVLCRPYVEYKGAVPQNELQSKQNELQAEASNLITKGGKVSVSILPYDKASELCGGSL 66 GY P+VEYKG+VPQ E Q KQ EL+AEA+ LI+KGGKV +ILPY++AS LCGGSL Sbjct: 140 GYHFPDGPFVEYKGSVPQEEFQVKQKELEAEANELISKGGKVYAAILPYEEASVLCGGSL 199 Query: 65 PDYIPKDSTPRIVQLGETLGC 3 PDYI K STPRI++LG++ GC Sbjct: 200 PDYISKGSTPRIIKLGDSPGC 220 >ref|NP_001078163.1| threonyl and alanyl tRNA synthetase second additional domain-containing protein [Arabidopsis thaliana] gi|332642317|gb|AEE75838.1| threonyl and alanyl tRNA synthetase second additional domain-containing protein [Arabidopsis thaliana] Length = 256 Score = 112 bits (280), Expect = 5e-23 Identities = 53/81 (65%), Positives = 65/81 (80%) Frame = -2 Query: 245 GYRVLCRPYVEYKGAVPQNELQSKQNELQAEASNLITKGGKVSVSILPYDKASELCGGSL 66 GY P+VEYKG+VPQ E Q KQ EL+AEA+ LI+KGGKV +ILPY++AS LCGGSL Sbjct: 140 GYHFPDGPFVEYKGSVPQEEFQVKQKELEAEANELISKGGKVYAAILPYEEASVLCGGSL 199 Query: 65 PDYIPKDSTPRIVQLGETLGC 3 PDYI K STPRI++LG++ GC Sbjct: 200 PDYISKGSTPRIIKLGDSPGC 220 >ref|XP_006298642.1| hypothetical protein CARUB_v10014731mg [Capsella rubella] gi|482567351|gb|EOA31540.1| hypothetical protein CARUB_v10014731mg [Capsella rubella] Length = 187 Score = 112 bits (279), Expect = 7e-23 Identities = 53/81 (65%), Positives = 65/81 (80%) Frame = -2 Query: 245 GYRVLCRPYVEYKGAVPQNELQSKQNELQAEASNLITKGGKVSVSILPYDKASELCGGSL 66 GY P+VEYKG+V Q++L KQ EL+AEA+ LITKGGKV +ILPY++AS LCGGSL Sbjct: 71 GYHFPDGPFVEYKGSVSQDKLLVKQKELEAEANELITKGGKVDAAILPYEEASVLCGGSL 130 Query: 65 PDYIPKDSTPRIVQLGETLGC 3 PDYIPK STPRI++LG+ GC Sbjct: 131 PDYIPKGSTPRIIKLGDNPGC 151 >ref|XP_006406826.1| hypothetical protein EUTSA_v10021369mg [Eutrema salsugineum] gi|557107972|gb|ESQ48279.1| hypothetical protein EUTSA_v10021369mg [Eutrema salsugineum] Length = 256 Score = 111 bits (278), Expect = 9e-23 Identities = 53/81 (65%), Positives = 65/81 (80%) Frame = -2 Query: 245 GYRVLCRPYVEYKGAVPQNELQSKQNELQAEASNLITKGGKVSVSILPYDKASELCGGSL 66 GY P+VEYKG +PQ+ LQ KQ EL+AEA+ LI+KGGKV +ILPY++AS LCGG+L Sbjct: 140 GYHFPDGPFVEYKGILPQDVLQVKQKELEAEANELISKGGKVYAAILPYEEASVLCGGNL 199 Query: 65 PDYIPKDSTPRIVQLGETLGC 3 PDYIPK STPRI++LGE GC Sbjct: 200 PDYIPKGSTPRILRLGENPGC 220 >ref|XP_006840500.1| hypothetical protein AMTR_s00045p00197400 [Amborella trichopoda] gi|548842218|gb|ERN02175.1| hypothetical protein AMTR_s00045p00197400 [Amborella trichopoda] Length = 306 Score = 111 bits (278), Expect = 9e-23 Identities = 54/81 (66%), Positives = 63/81 (77%) Frame = -2 Query: 245 GYRVLCRPYVEYKGAVPQNELQSKQNELQAEASNLITKGGKVSVSILPYDKASELCGGSL 66 GY +VEYKG V NELQSKQ +L+ EA+ +I+ GGKV+ SILPY +A ELCGGSL Sbjct: 190 GYHFPDGAFVEYKGTVTLNELQSKQKDLEKEANVMISNGGKVTASILPYKEALELCGGSL 249 Query: 65 PDYIPKDSTPRIVQLGETLGC 3 PDYIPKDS+PRIVQLG LGC Sbjct: 250 PDYIPKDSSPRIVQLGNNLGC 270 >ref|XP_003609668.1| Alanyl-tRNA synthetase [Medicago truncatula] gi|355510723|gb|AES91865.1| Alanyl-tRNA synthetase [Medicago truncatula] Length = 258 Score = 111 bits (277), Expect = 1e-22 Identities = 50/74 (67%), Positives = 63/74 (85%) Frame = -2 Query: 224 PYVEYKGAVPQNELQSKQNELQAEASNLITKGGKVSVSILPYDKASELCGGSLPDYIPKD 45 P+VEYKG VPQNE+Q+KQ EL+ EA+ LI+ GGKVS IL YD+A++LCGG LPDY+PK+ Sbjct: 149 PWVEYKGVVPQNEMQNKQKELEIEANALISMGGKVSADILLYDEAAKLCGGILPDYVPKE 208 Query: 44 STPRIVQLGETLGC 3 STPRIVQ+G+ GC Sbjct: 209 STPRIVQIGDNPGC 222 >gb|ACJ84608.1| unknown [Medicago truncatula] gi|388493132|gb|AFK34632.1| unknown [Medicago truncatula] Length = 258 Score = 111 bits (277), Expect = 1e-22 Identities = 50/74 (67%), Positives = 63/74 (85%) Frame = -2 Query: 224 PYVEYKGAVPQNELQSKQNELQAEASNLITKGGKVSVSILPYDKASELCGGSLPDYIPKD 45 P+VEYKG VPQNE+Q+KQ EL+ EA+ LI+ GGKVS IL YD+A++LCGG LPDY+PK+ Sbjct: 149 PWVEYKGVVPQNEMQNKQKELEIEANALISMGGKVSADILLYDEAAKLCGGILPDYVPKE 208 Query: 44 STPRIVQLGETLGC 3 STPRIVQ+G+ GC Sbjct: 209 STPRIVQIGDNPGC 222 >ref|XP_007035578.1| Alanine-tRNA ligases,nucleic acid binding,ligases, forming aminoacyl-tRNA and related compounds,nucleotide binding,ATP binding isoform 5 [Theobroma cacao] gi|508714607|gb|EOY06504.1| Alanine-tRNA ligases,nucleic acid binding,ligases, forming aminoacyl-tRNA and related compounds,nucleotide binding,ATP binding isoform 5 [Theobroma cacao] Length = 245 Score = 110 bits (276), Expect = 2e-22 Identities = 49/81 (60%), Positives = 64/81 (79%) Frame = -2 Query: 245 GYRVLCRPYVEYKGAVPQNELQSKQNELQAEASNLITKGGKVSVSILPYDKASELCGGSL 66 GY P+VEYKG +P NELQSKQ EL+ E + LI+KGGKV ++LPY++A+ELCGGSL Sbjct: 129 GYHFPDGPFVEYKGTIPPNELQSKQRELEMEVNALISKGGKVYATVLPYEEAAELCGGSL 188 Query: 65 PDYIPKDSTPRIVQLGETLGC 3 PDYIP+ S PRI+++G+ GC Sbjct: 189 PDYIPQGSNPRIIKIGDNPGC 209 >ref|XP_007035576.1| Alanine-tRNA ligases,nucleic acid binding,ligases, forming aminoacyl-tRNA and related compounds,nucleotide binding,ATP binding isoform 3 [Theobroma cacao] gi|508714605|gb|EOY06502.1| Alanine-tRNA ligases,nucleic acid binding,ligases, forming aminoacyl-tRNA and related compounds,nucleotide binding,ATP binding isoform 3 [Theobroma cacao] Length = 233 Score = 110 bits (276), Expect = 2e-22 Identities = 49/81 (60%), Positives = 64/81 (79%) Frame = -2 Query: 245 GYRVLCRPYVEYKGAVPQNELQSKQNELQAEASNLITKGGKVSVSILPYDKASELCGGSL 66 GY P+VEYKG +P NELQSKQ EL+ E + LI+KGGKV ++LPY++A+ELCGGSL Sbjct: 129 GYHFPDGPFVEYKGTIPPNELQSKQRELEMEVNALISKGGKVYATVLPYEEAAELCGGSL 188 Query: 65 PDYIPKDSTPRIVQLGETLGC 3 PDYIP+ S PRI+++G+ GC Sbjct: 189 PDYIPQGSNPRIIKIGDNPGC 209 >ref|XP_007035575.1| Alanine-tRNA ligases,nucleic acid binding,ligases, forming aminoacyl-tRNA and related compounds,nucleotide binding,ATP binding isoform 2 [Theobroma cacao] gi|508714604|gb|EOY06501.1| Alanine-tRNA ligases,nucleic acid binding,ligases, forming aminoacyl-tRNA and related compounds,nucleotide binding,ATP binding isoform 2 [Theobroma cacao] Length = 245 Score = 110 bits (276), Expect = 2e-22 Identities = 49/81 (60%), Positives = 64/81 (79%) Frame = -2 Query: 245 GYRVLCRPYVEYKGAVPQNELQSKQNELQAEASNLITKGGKVSVSILPYDKASELCGGSL 66 GY P+VEYKG +P NELQSKQ EL+ E + LI+KGGKV ++LPY++A+ELCGGSL Sbjct: 141 GYHFPDGPFVEYKGTIPPNELQSKQRELEMEVNALISKGGKVYATVLPYEEAAELCGGSL 200 Query: 65 PDYIPKDSTPRIVQLGETLGC 3 PDYIP+ S PRI+++G+ GC Sbjct: 201 PDYIPQGSNPRIIKIGDNPGC 221 >ref|XP_007035574.1| Alanine-tRNA ligases,nucleic acid binding,ligases, forming aminoacyl-tRNA and related compounds,nucleotide binding,ATP binding isoform 1 [Theobroma cacao] gi|590661085|ref|XP_007035577.1| Alanine-tRNA ligases,nucleic acid binding,ligases, forming aminoacyl-tRNA and related compounds,nucleotide binding,ATP binding isoform 1 [Theobroma cacao] gi|508714603|gb|EOY06500.1| Alanine-tRNA ligases,nucleic acid binding,ligases, forming aminoacyl-tRNA and related compounds,nucleotide binding,ATP binding isoform 1 [Theobroma cacao] gi|508714606|gb|EOY06503.1| Alanine-tRNA ligases,nucleic acid binding,ligases, forming aminoacyl-tRNA and related compounds,nucleotide binding,ATP binding isoform 1 [Theobroma cacao] Length = 257 Score = 110 bits (276), Expect = 2e-22 Identities = 49/81 (60%), Positives = 64/81 (79%) Frame = -2 Query: 245 GYRVLCRPYVEYKGAVPQNELQSKQNELQAEASNLITKGGKVSVSILPYDKASELCGGSL 66 GY P+VEYKG +P NELQSKQ EL+ E + LI+KGGKV ++LPY++A+ELCGGSL Sbjct: 141 GYHFPDGPFVEYKGTIPPNELQSKQRELEMEVNALISKGGKVYATVLPYEEAAELCGGSL 200 Query: 65 PDYIPKDSTPRIVQLGETLGC 3 PDYIP+ S PRI+++G+ GC Sbjct: 201 PDYIPQGSNPRIIKIGDNPGC 221 >ref|XP_002885151.1| ATP binding protein [Arabidopsis lyrata subsp. lyrata] gi|297330991|gb|EFH61410.1| ATP binding protein [Arabidopsis lyrata subsp. lyrata] Length = 256 Score = 110 bits (275), Expect = 2e-22 Identities = 51/81 (62%), Positives = 66/81 (81%) Frame = -2 Query: 245 GYRVLCRPYVEYKGAVPQNELQSKQNELQAEASNLITKGGKVSVSILPYDKASELCGGSL 66 GY P+VEYKG+VPQ ++ KQ EL+AEA++LITKGGKV +ILPY++AS LCGG+L Sbjct: 140 GYHFPDGPFVEYKGSVPQGQMAVKQKELEAEANDLITKGGKVYAAILPYEEASVLCGGNL 199 Query: 65 PDYIPKDSTPRIVQLGETLGC 3 PDYI K STPRI++LG++ GC Sbjct: 200 PDYISKGSTPRIIKLGDSPGC 220 >gb|EYU45553.1| hypothetical protein MIMGU_mgv1a012367mg [Mimulus guttatus] Length = 210 Score = 109 bits (273), Expect = 3e-22 Identities = 52/68 (76%), Positives = 58/68 (85%) Frame = -2 Query: 245 GYRVLCRPYVEYKGAVPQNELQSKQNELQAEASNLITKGGKVSVSILPYDKASELCGGSL 66 GY P+VEYKG VPQNEL SK+ EL+ EASNLI+KGGKVS+SI+PYDKASELCGGSL Sbjct: 137 GYHFQDGPFVEYKGVVPQNELHSKKTELELEASNLISKGGKVSISIVPYDKASELCGGSL 196 Query: 65 PDYIPKDS 42 PDYIPK S Sbjct: 197 PDYIPKHS 204 >ref|XP_002273600.1| PREDICTED: alanyl-tRNA editing protein AlaX-L-like [Vitis vinifera] Length = 256 Score = 109 bits (273), Expect = 3e-22 Identities = 51/81 (62%), Positives = 62/81 (76%) Frame = -2 Query: 245 GYRVLCRPYVEYKGAVPQNELQSKQNELQAEASNLITKGGKVSVSILPYDKASELCGGSL 66 GY P+VEYKG VPQNELQ KQ EL+ +A+ LI++GGKVS +LPY +A ELCGG L Sbjct: 140 GYHFPDGPFVEYKGVVPQNELQGKQKELELDANALISRGGKVSAVVLPYAEAVELCGGCL 199 Query: 65 PDYIPKDSTPRIVQLGETLGC 3 PDYIPK S PRI++LG+ GC Sbjct: 200 PDYIPKSSNPRILKLGDNPGC 220 >emb|CBI26074.3| unnamed protein product [Vitis vinifera] Length = 243 Score = 109 bits (273), Expect = 3e-22 Identities = 51/81 (62%), Positives = 62/81 (76%) Frame = -2 Query: 245 GYRVLCRPYVEYKGAVPQNELQSKQNELQAEASNLITKGGKVSVSILPYDKASELCGGSL 66 GY P+VEYKG VPQNELQ KQ EL+ +A+ LI++GGKVS +LPY +A ELCGG L Sbjct: 127 GYHFPDGPFVEYKGVVPQNELQGKQKELELDANALISRGGKVSAVVLPYAEAVELCGGCL 186 Query: 65 PDYIPKDSTPRIVQLGETLGC 3 PDYIPK S PRI++LG+ GC Sbjct: 187 PDYIPKSSNPRILKLGDNPGC 207