BLASTX nr result
ID: Mentha26_contig00013189
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00013189 (399 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS61281.1| secretory carrier-associated membrane protein 2 [... 70 2e-10 gb|EYU23286.1| hypothetical protein MIMGU_mgv1a011911mg [Mimulus... 70 3e-10 ref|XP_004146111.1| PREDICTED: secretory carrier-associated memb... 70 3e-10 dbj|BAH03477.1| secretory carrier-associated membrane protein 2 ... 69 5e-10 ref|XP_006352923.1| PREDICTED: secretory carrier-associated memb... 69 7e-10 ref|XP_004300171.1| PREDICTED: secretory carrier-associated memb... 69 7e-10 gb|EXC26238.1| Secretory carrier-associated membrane protein 3 [... 68 1e-09 ref|XP_002303454.1| secretory carrier membrane family protein [P... 67 2e-09 ref|XP_007158207.1| hypothetical protein PHAVU_002G133200g [Phas... 67 3e-09 ref|NP_001241252.1| uncharacterized protein LOC100806586 [Glycin... 67 3e-09 ref|XP_002519001.1| secretory carrier membrane protein, putative... 67 3e-09 ref|XP_006368326.1| secretory carrier membrane family protein [P... 66 4e-09 ref|XP_006368327.1| hypothetical protein POPTR_0001s01640g [Popu... 66 4e-09 ref|XP_007209463.1| hypothetical protein PRUPE_ppa009893mg [Prun... 65 7e-09 gb|AFK41920.1| unknown [Lotus japonicus] 65 1e-08 ref|NP_001241214.1| uncharacterized protein LOC100780723 [Glycin... 65 1e-08 gb|ACU18292.1| unknown [Glycine max] 65 1e-08 ref|XP_006415261.1| hypothetical protein EUTSA_v10008500mg [Eutr... 65 1e-08 ref|XP_004512452.1| PREDICTED: secretory carrier-associated memb... 64 2e-08 ref|NP_001151958.1| LOC100285595 [Zea mays] gi|195651353|gb|ACG4... 64 2e-08 >gb|EPS61281.1| secretory carrier-associated membrane protein 2 [Genlisea aurea] Length = 266 Score = 70.5 bits (171), Expect = 2e-10 Identities = 30/36 (83%), Positives = 35/36 (97%) Frame = -2 Query: 398 VIVGIFYLIGFAFFCLESLLSLWVLQKVYTYFRGQK 291 V+VG+FYLIGF FFCLE+LLSLWVLQKVY+YFRGQ+ Sbjct: 231 VLVGVFYLIGFGFFCLEALLSLWVLQKVYSYFRGQR 266 >gb|EYU23286.1| hypothetical protein MIMGU_mgv1a011911mg [Mimulus guttatus] Length = 267 Score = 70.1 bits (170), Expect = 3e-10 Identities = 31/36 (86%), Positives = 33/36 (91%) Frame = -2 Query: 398 VIVGIFYLIGFAFFCLESLLSLWVLQKVYTYFRGQK 291 V+VGIFYL+GF FFCLESLLSLWVLQKVY YFRG K Sbjct: 232 VLVGIFYLLGFGFFCLESLLSLWVLQKVYAYFRGNK 267 >ref|XP_004146111.1| PREDICTED: secretory carrier-associated membrane protein 4-like [Cucumis sativus] Length = 269 Score = 70.1 bits (170), Expect = 3e-10 Identities = 31/36 (86%), Positives = 33/36 (91%) Frame = -2 Query: 398 VIVGIFYLIGFAFFCLESLLSLWVLQKVYTYFRGQK 291 V+VGIFYLIGF FFCLESLLSLWVLQK+Y YFRG K Sbjct: 234 VLVGIFYLIGFGFFCLESLLSLWVLQKIYLYFRGNK 269 >dbj|BAH03477.1| secretory carrier-associated membrane protein 2 [Nicotiana tabacum] Length = 271 Score = 69.3 bits (168), Expect = 5e-10 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = -2 Query: 398 VIVGIFYLIGFAFFCLESLLSLWVLQKVYTYFRGQK 291 V+VGIFYLIGFAFFCLE+LLSLWVLQKVY +FRG K Sbjct: 236 VLVGIFYLIGFAFFCLEALLSLWVLQKVYMFFRGHK 271 >ref|XP_006352923.1| PREDICTED: secretory carrier-associated membrane protein 4-like [Solanum tuberosum] Length = 270 Score = 68.9 bits (167), Expect = 7e-10 Identities = 31/36 (86%), Positives = 32/36 (88%) Frame = -2 Query: 398 VIVGIFYLIGFAFFCLESLLSLWVLQKVYTYFRGQK 291 V+VGIFYLIGF FFCLE LLSLWVLQKVY YFRG K Sbjct: 235 VLVGIFYLIGFGFFCLEGLLSLWVLQKVYMYFRGNK 270 >ref|XP_004300171.1| PREDICTED: secretory carrier-associated membrane protein 4-like [Fragaria vesca subsp. vesca] Length = 263 Score = 68.9 bits (167), Expect = 7e-10 Identities = 31/36 (86%), Positives = 32/36 (88%) Frame = -2 Query: 398 VIVGIFYLIGFAFFCLESLLSLWVLQKVYTYFRGQK 291 VIVGIFYLIGFA FCLESLLS WVLQK+Y YFRG K Sbjct: 228 VIVGIFYLIGFALFCLESLLSFWVLQKIYVYFRGNK 263 >gb|EXC26238.1| Secretory carrier-associated membrane protein 3 [Morus notabilis] Length = 325 Score = 67.8 bits (164), Expect = 1e-09 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = -2 Query: 398 VIVGIFYLIGFAFFCLESLLSLWVLQKVYTYFRGQK 291 V+VGIFYL+GF FCLESLLSLWVLQKVY YFRG K Sbjct: 290 VLVGIFYLVGFGLFCLESLLSLWVLQKVYLYFRGHK 325 >ref|XP_002303454.1| secretory carrier membrane family protein [Populus trichocarpa] gi|118486235|gb|ABK94959.1| unknown [Populus trichocarpa] gi|222840886|gb|EEE78433.1| secretory carrier membrane family protein [Populus trichocarpa] Length = 270 Score = 67.4 bits (163), Expect = 2e-09 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = -2 Query: 398 VIVGIFYLIGFAFFCLESLLSLWVLQKVYTYFRGQK 291 V+VGIFYL+GF FCLESLLSLWVLQK+Y YFRG K Sbjct: 235 VLVGIFYLVGFGLFCLESLLSLWVLQKIYMYFRGNK 270 >ref|XP_007158207.1| hypothetical protein PHAVU_002G133200g [Phaseolus vulgaris] gi|561031622|gb|ESW30201.1| hypothetical protein PHAVU_002G133200g [Phaseolus vulgaris] Length = 262 Score = 66.6 bits (161), Expect = 3e-09 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = -2 Query: 398 VIVGIFYLIGFAFFCLESLLSLWVLQKVYTYFRGQK 291 V+VGIFYLIGF FCLE+LLSLWVLQK+Y YFRG K Sbjct: 227 VLVGIFYLIGFGLFCLEALLSLWVLQKIYMYFRGHK 262 >ref|NP_001241252.1| uncharacterized protein LOC100806586 [Glycine max] gi|255638153|gb|ACU19390.1| unknown [Glycine max] Length = 269 Score = 66.6 bits (161), Expect = 3e-09 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = -2 Query: 398 VIVGIFYLIGFAFFCLESLLSLWVLQKVYTYFRGQK 291 V+VGIFYLIGF FCLE+LLSLWVLQK+Y YFRG K Sbjct: 234 VLVGIFYLIGFGMFCLEALLSLWVLQKIYMYFRGHK 269 >ref|XP_002519001.1| secretory carrier membrane protein, putative [Ricinus communis] gi|223541988|gb|EEF43534.1| secretory carrier membrane protein, putative [Ricinus communis] Length = 272 Score = 66.6 bits (161), Expect = 3e-09 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = -2 Query: 398 VIVGIFYLIGFAFFCLESLLSLWVLQKVYTYFRGQK 291 ++VGIFYL+GF FCLESLLSLWVLQKVY YFRG K Sbjct: 234 LLVGIFYLVGFGLFCLESLLSLWVLQKVYMYFRGHK 269 >ref|XP_006368326.1| secretory carrier membrane family protein [Populus trichocarpa] gi|550346231|gb|ERP64895.1| secretory carrier membrane family protein [Populus trichocarpa] Length = 269 Score = 66.2 bits (160), Expect = 4e-09 Identities = 28/36 (77%), Positives = 32/36 (88%) Frame = -2 Query: 398 VIVGIFYLIGFAFFCLESLLSLWVLQKVYTYFRGQK 291 ++VGIFYL+GF FCLESLLSLWVLQK+Y YFRG K Sbjct: 234 LLVGIFYLVGFGLFCLESLLSLWVLQKIYMYFRGHK 269 >ref|XP_006368327.1| hypothetical protein POPTR_0001s01640g [Populus trichocarpa] gi|118482846|gb|ABK93338.1| unknown [Populus trichocarpa] gi|550346232|gb|ERP64896.1| hypothetical protein POPTR_0001s01640g [Populus trichocarpa] Length = 270 Score = 66.2 bits (160), Expect = 4e-09 Identities = 28/36 (77%), Positives = 32/36 (88%) Frame = -2 Query: 398 VIVGIFYLIGFAFFCLESLLSLWVLQKVYTYFRGQK 291 ++VGIFYL+GF FCLESLLSLWVLQK+Y YFRG K Sbjct: 235 LLVGIFYLVGFGLFCLESLLSLWVLQKIYMYFRGHK 270 >ref|XP_007209463.1| hypothetical protein PRUPE_ppa009893mg [Prunus persica] gi|462405198|gb|EMJ10662.1| hypothetical protein PRUPE_ppa009893mg [Prunus persica] Length = 273 Score = 65.5 bits (158), Expect = 7e-09 Identities = 29/36 (80%), Positives = 31/36 (86%) Frame = -2 Query: 398 VIVGIFYLIGFAFFCLESLLSLWVLQKVYTYFRGQK 291 V+VGIFYL GFA FCLE+LLS WVLQKVY YFRG K Sbjct: 238 VVVGIFYLTGFALFCLETLLSFWVLQKVYMYFRGNK 273 >gb|AFK41920.1| unknown [Lotus japonicus] Length = 268 Score = 65.1 bits (157), Expect = 1e-08 Identities = 27/36 (75%), Positives = 32/36 (88%) Frame = -2 Query: 398 VIVGIFYLIGFAFFCLESLLSLWVLQKVYTYFRGQK 291 V+VGIFYL+GF FCLESLLSLWV+QK+Y +FRG K Sbjct: 233 VLVGIFYLVGFGLFCLESLLSLWVIQKIYLFFRGHK 268 >ref|NP_001241214.1| uncharacterized protein LOC100780723 [Glycine max] gi|255641378|gb|ACU20966.1| unknown [Glycine max] Length = 269 Score = 65.1 bits (157), Expect = 1e-08 Identities = 28/36 (77%), Positives = 31/36 (86%) Frame = -2 Query: 398 VIVGIFYLIGFAFFCLESLLSLWVLQKVYTYFRGQK 291 V+VGIFYLIGF FCLE+LLS WVLQK+Y YFRG K Sbjct: 234 VLVGIFYLIGFGMFCLEALLSFWVLQKIYMYFRGHK 269 >gb|ACU18292.1| unknown [Glycine max] Length = 88 Score = 65.1 bits (157), Expect = 1e-08 Identities = 28/36 (77%), Positives = 31/36 (86%) Frame = -2 Query: 398 VIVGIFYLIGFAFFCLESLLSLWVLQKVYTYFRGQK 291 V+VGIFYLIGF FCLE+LLS WVLQK+Y YFRG K Sbjct: 53 VLVGIFYLIGFGMFCLEALLSFWVLQKIYMYFRGHK 88 >ref|XP_006415261.1| hypothetical protein EUTSA_v10008500mg [Eutrema salsugineum] gi|567145492|ref|XP_006415262.1| hypothetical protein EUTSA_v10008500mg [Eutrema salsugineum] gi|557093032|gb|ESQ33614.1| hypothetical protein EUTSA_v10008500mg [Eutrema salsugineum] gi|557093033|gb|ESQ33615.1| hypothetical protein EUTSA_v10008500mg [Eutrema salsugineum] Length = 264 Score = 64.7 bits (156), Expect = 1e-08 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = -2 Query: 398 VIVGIFYLIGFAFFCLESLLSLWVLQKVYTYFRGQK 291 V+ GIFY IGF FCLESLLSLWVLQK+Y YFRG K Sbjct: 229 VLAGIFYFIGFGLFCLESLLSLWVLQKIYLYFRGNK 264 >ref|XP_004512452.1| PREDICTED: secretory carrier-associated membrane protein 4-like [Cicer arietinum] Length = 267 Score = 64.3 bits (155), Expect = 2e-08 Identities = 27/36 (75%), Positives = 32/36 (88%) Frame = -2 Query: 398 VIVGIFYLIGFAFFCLESLLSLWVLQKVYTYFRGQK 291 V+VGIFYLIGF FCLE+LLSLWV+QK+Y +FRG K Sbjct: 232 VLVGIFYLIGFGLFCLEALLSLWVIQKIYMFFRGHK 267 >ref|NP_001151958.1| LOC100285595 [Zea mays] gi|195651353|gb|ACG45144.1| SC3 protein [Zea mays] Length = 316 Score = 64.3 bits (155), Expect = 2e-08 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = -2 Query: 398 VIVGIFYLIGFAFFCLESLLSLWVLQKVYTYFRG 297 VIVGIFY IGFA FCLESLLS+WV+Q+VY YFRG Sbjct: 263 VIVGIFYFIGFALFCLESLLSMWVIQRVYLYFRG 296