BLASTX nr result
ID: Mentha26_contig00013038
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00013038 (427 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU31955.1| hypothetical protein MIMGU_mgv1a007444mg [Mimulus... 76 4e-12 >gb|EYU31955.1| hypothetical protein MIMGU_mgv1a007444mg [Mimulus guttatus] Length = 407 Score = 76.3 bits (186), Expect = 4e-12 Identities = 47/87 (54%), Positives = 53/87 (60%), Gaps = 7/87 (8%) Frame = +3 Query: 186 MAQQIVEFDRIALAPLSVTSLCSCRPHSDFRHRPTLQRFAAQSNFQKFRFKFDVND---- 353 MA Q VEF+RIALAPLSVTSLCSCR +S RP + + NFQKFRF ++N Sbjct: 1 MAPQAVEFNRIALAPLSVTSLCSCRSNSG--RRPIFPKLTSPPNFQKFRFNLELNSDSTR 58 Query: 354 ---RIHRGVLVNQRRRVIRGVARAELP 425 RI G L RRRVI VA AE P Sbjct: 59 RIYRIPSGALFKNRRRVISAVA-AEQP 84