BLASTX nr result
ID: Mentha26_contig00012987
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00012987 (309 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAY52461.1| dehydroascorbate reductase [Lotus japonicus] 74 2e-11 ref|XP_004503134.1| PREDICTED: glutathione S-transferase DHAR3, ... 71 2e-10 ref|NP_001236929.1| dehydroascorbate reductase [Glycine max] gi|... 70 4e-10 gb|AAY85185.1| dehydroascorbate reductase [Medicago truncatula] 70 4e-10 ref|XP_003538394.1| PREDICTED: glutathione S-transferase DHAR3, ... 70 4e-10 gb|ACU21042.1| unknown [Glycine max] 70 4e-10 gb|EYU45808.1| hypothetical protein MIMGU_mgv1a012701mg [Mimulus... 69 5e-10 gb|AGY14487.1| dehydroascorbate reductase [Cicer arietinum] 69 9e-10 ref|NP_001234224.1| dehydroascorbate reductase [Solanum lycopers... 66 6e-09 ref|XP_007163386.1| hypothetical protein PHAVU_001G230400g [Phas... 65 7e-09 ref|NP_001275053.1| dehydroascorbate reductase [Solanum tuberosu... 64 3e-08 ref|XP_004145855.1| PREDICTED: glutathione S-transferase DHAR3, ... 63 4e-08 gb|AFF18803.1| dehydroascorbate reductase, partial [Dimocarpus l... 63 5e-08 gb|AEO36982.1| dehydroascorbate reductase [Dimocarpus longan] 63 5e-08 gb|EXC20643.1| Glutathione S-transferase [Morus notabilis] 62 8e-08 ref|XP_006400211.1| hypothetical protein EUTSA_v10014453mg [Eutr... 61 1e-07 ref|XP_006400210.1| hypothetical protein EUTSA_v10014453mg [Eutr... 61 1e-07 ref|XP_006656816.1| PREDICTED: glutathione S-transferase DHAR3, ... 61 2e-07 gb|AAN04049.1| dehydroascorbate reductase [Brassica juncea] 61 2e-07 ref|XP_007033021.1| Dehydroascorbate reductase 1 isoform 3 [Theo... 60 2e-07 >gb|AAY52461.1| dehydroascorbate reductase [Lotus japonicus] Length = 261 Score = 73.9 bits (180), Expect = 2e-11 Identities = 33/41 (80%), Positives = 37/41 (90%) Frame = +2 Query: 2 IPDSLTYIKSYMKTIFSRESFIKTRAQVQDAIEGWRSKVEG 124 +PDSLT++KSYMK IFSRESFIKTRAQ QD +EGWR KVEG Sbjct: 221 VPDSLTFLKSYMKAIFSRESFIKTRAQPQDVVEGWRPKVEG 261 >ref|XP_004503134.1| PREDICTED: glutathione S-transferase DHAR3, chloroplastic-like [Cicer arietinum] Length = 264 Score = 70.9 bits (172), Expect = 2e-10 Identities = 33/41 (80%), Positives = 36/41 (87%) Frame = +2 Query: 2 IPDSLTYIKSYMKTIFSRESFIKTRAQVQDAIEGWRSKVEG 124 IPDSLT++KSY+K IFSRESFI TRAQ QD IEGWR KVEG Sbjct: 224 IPDSLTFLKSYIKDIFSRESFINTRAQPQDVIEGWRPKVEG 264 >ref|NP_001236929.1| dehydroascorbate reductase [Glycine max] gi|68131811|gb|AAY85184.1| dehydroascorbate reductase [Glycine max] Length = 259 Score = 69.7 bits (169), Expect = 4e-10 Identities = 32/41 (78%), Positives = 35/41 (85%) Frame = +2 Query: 2 IPDSLTYIKSYMKTIFSRESFIKTRAQVQDAIEGWRSKVEG 124 +PDSLT +KSYMK IFSRESF+KT AQ QD IEGWR KVEG Sbjct: 219 VPDSLTSLKSYMKAIFSRESFVKTSAQPQDVIEGWRPKVEG 259 >gb|AAY85185.1| dehydroascorbate reductase [Medicago truncatula] Length = 264 Score = 69.7 bits (169), Expect = 4e-10 Identities = 31/41 (75%), Positives = 36/41 (87%) Frame = +2 Query: 2 IPDSLTYIKSYMKTIFSRESFIKTRAQVQDAIEGWRSKVEG 124 +PDSLT++KSY+K IFSRESFI TRAQ +D IEGWR KVEG Sbjct: 224 VPDSLTFLKSYLKEIFSRESFINTRAQPEDVIEGWRPKVEG 264 >ref|XP_003538394.1| PREDICTED: glutathione S-transferase DHAR3, chloroplastic [Glycine max] Length = 259 Score = 69.7 bits (169), Expect = 4e-10 Identities = 32/41 (78%), Positives = 35/41 (85%) Frame = +2 Query: 2 IPDSLTYIKSYMKTIFSRESFIKTRAQVQDAIEGWRSKVEG 124 +PDSLT +KSYMK IFSRESF+KT AQ QD IEGWR KVEG Sbjct: 219 VPDSLTSLKSYMKVIFSRESFVKTSAQPQDVIEGWRPKVEG 259 >gb|ACU21042.1| unknown [Glycine max] Length = 261 Score = 69.7 bits (169), Expect = 4e-10 Identities = 32/41 (78%), Positives = 35/41 (85%) Frame = +2 Query: 2 IPDSLTYIKSYMKTIFSRESFIKTRAQVQDAIEGWRSKVEG 124 +PDSLT +KSYMK IFSRESF+KT AQ QD IEGWR KVEG Sbjct: 221 VPDSLTSLKSYMKAIFSRESFVKTSAQPQDVIEGWRPKVEG 261 >gb|EYU45808.1| hypothetical protein MIMGU_mgv1a012701mg [Mimulus guttatus] Length = 242 Score = 69.3 bits (168), Expect = 5e-10 Identities = 30/41 (73%), Positives = 36/41 (87%) Frame = +2 Query: 2 IPDSLTYIKSYMKTIFSRESFIKTRAQVQDAIEGWRSKVEG 124 IPDSLTY+ SYMKTIFS++SF+ TRA+ +D IEGWR KVEG Sbjct: 202 IPDSLTYVNSYMKTIFSKDSFVNTRAEPKDVIEGWRPKVEG 242 >gb|AGY14487.1| dehydroascorbate reductase [Cicer arietinum] Length = 264 Score = 68.6 bits (166), Expect = 9e-10 Identities = 32/41 (78%), Positives = 35/41 (85%) Frame = +2 Query: 2 IPDSLTYIKSYMKTIFSRESFIKTRAQVQDAIEGWRSKVEG 124 IPDSLT++KSY+K IFSRES I TRAQ QD IEGWR KVEG Sbjct: 224 IPDSLTFLKSYIKDIFSRESLINTRAQPQDVIEGWRPKVEG 264 >ref|NP_001234224.1| dehydroascorbate reductase [Solanum lycopersicum] gi|66475038|gb|AAY47049.1| dehydroascorbate reductase [Solanum lycopersicum] Length = 268 Score = 65.9 bits (159), Expect = 6e-09 Identities = 31/41 (75%), Positives = 35/41 (85%) Frame = +2 Query: 2 IPDSLTYIKSYMKTIFSRESFIKTRAQVQDAIEGWRSKVEG 124 IPDSL+Y+KSYMK+IFSRESFI TRA +D IEGWR KV G Sbjct: 228 IPDSLSYMKSYMKSIFSRESFIHTRALKEDVIEGWRPKVMG 268 >ref|XP_007163386.1| hypothetical protein PHAVU_001G230400g [Phaseolus vulgaris] gi|561036850|gb|ESW35380.1| hypothetical protein PHAVU_001G230400g [Phaseolus vulgaris] Length = 262 Score = 65.5 bits (158), Expect = 7e-09 Identities = 31/41 (75%), Positives = 33/41 (80%) Frame = +2 Query: 2 IPDSLTYIKSYMKTIFSRESFIKTRAQVQDAIEGWRSKVEG 124 +PDSLT +KSY K IF RESFIKT AQ QD IEGWR KVEG Sbjct: 222 VPDSLTSLKSYTKAIFLRESFIKTSAQPQDVIEGWRPKVEG 262 >ref|NP_001275053.1| dehydroascorbate reductase [Solanum tuberosum] gi|123187087|gb|ABM69253.1| dehydroascorbate reductase [Solanum tuberosum] gi|215794047|gb|ACJ70069.1| dehydroascorbate reductase [Solanum tuberosum] Length = 268 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/41 (70%), Positives = 34/41 (82%) Frame = +2 Query: 2 IPDSLTYIKSYMKTIFSRESFIKTRAQVQDAIEGWRSKVEG 124 IPDSL+Y+KSYM++ FSRESFI TRA +D IEGWR KV G Sbjct: 228 IPDSLSYVKSYMESTFSRESFINTRALKEDVIEGWRPKVMG 268 >ref|XP_004145855.1| PREDICTED: glutathione S-transferase DHAR3, chloroplastic-like isoform 1 [Cucumis sativus] gi|449484569|ref|XP_004156918.1| PREDICTED: glutathione S-transferase DHAR3, chloroplastic-like isoform 1 [Cucumis sativus] Length = 270 Score = 63.2 bits (152), Expect = 4e-08 Identities = 29/41 (70%), Positives = 33/41 (80%) Frame = +2 Query: 2 IPDSLTYIKSYMKTIFSRESFIKTRAQVQDAIEGWRSKVEG 124 +PDSL Y+KSYMK+IFSRESF KTRA +D I GWR KV G Sbjct: 230 VPDSLPYVKSYMKSIFSRESFAKTRALPEDVIAGWRPKVLG 270 >gb|AFF18803.1| dehydroascorbate reductase, partial [Dimocarpus longan] Length = 267 Score = 62.8 bits (151), Expect = 5e-08 Identities = 29/41 (70%), Positives = 33/41 (80%) Frame = +2 Query: 2 IPDSLTYIKSYMKTIFSRESFIKTRAQVQDAIEGWRSKVEG 124 +PDSL Y+KSYMKTIFS +SFIKTRA +D I GWR KV G Sbjct: 227 VPDSLPYVKSYMKTIFSLDSFIKTRALQEDVIAGWRPKVLG 267 >gb|AEO36982.1| dehydroascorbate reductase [Dimocarpus longan] Length = 174 Score = 62.8 bits (151), Expect = 5e-08 Identities = 29/41 (70%), Positives = 33/41 (80%) Frame = +2 Query: 2 IPDSLTYIKSYMKTIFSRESFIKTRAQVQDAIEGWRSKVEG 124 +PDSL Y+KSYMKTIFS +SFIKTRA +D I GWR KV G Sbjct: 134 VPDSLPYVKSYMKTIFSLDSFIKTRALQEDVIAGWRPKVLG 174 >gb|EXC20643.1| Glutathione S-transferase [Morus notabilis] Length = 361 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/38 (71%), Positives = 33/38 (86%) Frame = +2 Query: 2 IPDSLTYIKSYMKTIFSRESFIKTRAQVQDAIEGWRSK 115 +PDSL Y+KSYM+TIFS++SFIKTRA +D I GWRSK Sbjct: 242 VPDSLPYVKSYMQTIFSKDSFIKTRALPEDVIAGWRSK 279 >ref|XP_006400211.1| hypothetical protein EUTSA_v10014453mg [Eutrema salsugineum] gi|557101301|gb|ESQ41664.1| hypothetical protein EUTSA_v10014453mg [Eutrema salsugineum] Length = 183 Score = 61.2 bits (147), Expect = 1e-07 Identities = 25/41 (60%), Positives = 33/41 (80%) Frame = +2 Query: 2 IPDSLTYIKSYMKTIFSRESFIKTRAQVQDAIEGWRSKVEG 124 +PDSL+++KSYM+ +FSRESF KTR Q +D I GW+ KV G Sbjct: 143 VPDSLSFVKSYMENVFSRESFAKTRGQTEDVIAGWKPKVMG 183 >ref|XP_006400210.1| hypothetical protein EUTSA_v10014453mg [Eutrema salsugineum] gi|557101300|gb|ESQ41663.1| hypothetical protein EUTSA_v10014453mg [Eutrema salsugineum] Length = 257 Score = 61.2 bits (147), Expect = 1e-07 Identities = 25/41 (60%), Positives = 33/41 (80%) Frame = +2 Query: 2 IPDSLTYIKSYMKTIFSRESFIKTRAQVQDAIEGWRSKVEG 124 +PDSL+++KSYM+ +FSRESF KTR Q +D I GW+ KV G Sbjct: 217 VPDSLSFVKSYMENVFSRESFAKTRGQTEDVIAGWKPKVMG 257 >ref|XP_006656816.1| PREDICTED: glutathione S-transferase DHAR3, chloroplastic-like [Oryza brachyantha] Length = 245 Score = 60.8 bits (146), Expect = 2e-07 Identities = 26/41 (63%), Positives = 34/41 (82%) Frame = +2 Query: 2 IPDSLTYIKSYMKTIFSRESFIKTRAQVQDAIEGWRSKVEG 124 +PDSL+++K+YMKTIFS +SF+KTRA +D I GWR KV G Sbjct: 205 VPDSLSHVKNYMKTIFSMDSFVKTRALQEDVIAGWRPKVMG 245 >gb|AAN04049.1| dehydroascorbate reductase [Brassica juncea] Length = 217 Score = 60.8 bits (146), Expect = 2e-07 Identities = 26/41 (63%), Positives = 33/41 (80%) Frame = +2 Query: 2 IPDSLTYIKSYMKTIFSRESFIKTRAQVQDAIEGWRSKVEG 124 +PDSL+++KSYM+ +FSRESF KT AQ +D I GWR KV G Sbjct: 177 VPDSLSFLKSYMENVFSRESFKKTEAQTEDVIAGWRPKVMG 217 >ref|XP_007033021.1| Dehydroascorbate reductase 1 isoform 3 [Theobroma cacao] gi|508712050|gb|EOY03947.1| Dehydroascorbate reductase 1 isoform 3 [Theobroma cacao] Length = 211 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/41 (63%), Positives = 32/41 (78%) Frame = +2 Query: 2 IPDSLTYIKSYMKTIFSRESFIKTRAQVQDAIEGWRSKVEG 124 +PD+L Y+KSYM+TIFS +SF+KTRA D I GWR KV G Sbjct: 171 VPDTLPYVKSYMETIFSMDSFVKTRASPDDVIAGWRPKVMG 211