BLASTX nr result
ID: Mentha26_contig00012787
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00012787 (296 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU38917.1| hypothetical protein MIMGU_mgv1a0037492mg, partia... 60 2e-07 ref|XP_006444906.1| hypothetical protein CICLE_v10019570mg [Citr... 58 2e-06 ref|XP_006444905.1| hypothetical protein CICLE_v10019570mg [Citr... 58 2e-06 ref|XP_006402466.1| hypothetical protein EUTSA_v10005840mg [Eutr... 57 2e-06 ref|XP_006402465.1| hypothetical protein EUTSA_v10005840mg [Eutr... 57 2e-06 ref|XP_002511951.1| atpob1, putative [Ricinus communis] gi|22354... 57 2e-06 ref|XP_003548592.1| PREDICTED: BTB/POZ domain-containing protein... 57 3e-06 ref|XP_003528818.1| PREDICTED: BTB/POZ domain-containing protein... 57 3e-06 ref|XP_007051653.1| POZ/BTB containin G-protein 1 isoform 6 [The... 57 4e-06 ref|XP_007051652.1| POZ/BTB containin G-protein 1 isoform 5 [The... 57 4e-06 ref|XP_007051651.1| POZ/BTB containin G-protein 1 isoform 4 [The... 57 4e-06 ref|XP_007051650.1| POZ/BTB containin G-protein 1 isoform 3 [The... 57 4e-06 ref|XP_007051649.1| POZ/BTB containin G-protein 1 isoform 2 [The... 57 4e-06 ref|XP_007051648.1| POZ/BTB containin G-protein 1 isoform 1 [The... 57 4e-06 ref|XP_006293934.1| hypothetical protein CARUB_v10022924mg [Caps... 57 4e-06 ref|XP_006293933.1| hypothetical protein CARUB_v10022924mg [Caps... 57 4e-06 ref|XP_004306705.1| PREDICTED: BTB/POZ domain-containing protein... 56 5e-06 ref|XP_007135186.1| hypothetical protein PHAVU_010G108200g [Phas... 56 6e-06 ref|XP_007135185.1| hypothetical protein PHAVU_010G108100g [Phas... 56 6e-06 ref|XP_002320175.2| BTB/POZ domain-containing family protein [Po... 56 6e-06 >gb|EYU38917.1| hypothetical protein MIMGU_mgv1a0037492mg, partial [Mimulus guttatus] Length = 275 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/32 (81%), Positives = 31/32 (96%) Frame = -1 Query: 296 SIPWTSFMADDSLYFINDILHLRAELTIKREV 201 +IPWTSF+A+DSLYFIN +LHLRAELTIKRE+ Sbjct: 242 NIPWTSFVAEDSLYFINGVLHLRAELTIKREI 273 >ref|XP_006444906.1| hypothetical protein CICLE_v10019570mg [Citrus clementina] gi|557547168|gb|ESR58146.1| hypothetical protein CICLE_v10019570mg [Citrus clementina] Length = 550 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = -1 Query: 296 SIPWTSFMADDSLYFINDILHLRAELTIK 210 +IPWTSFMADDSLYFIN ILHLRAELTI+ Sbjct: 521 AIPWTSFMADDSLYFINGILHLRAELTIR 549 >ref|XP_006444905.1| hypothetical protein CICLE_v10019570mg [Citrus clementina] gi|568876298|ref|XP_006491218.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Citrus sinensis] gi|557547167|gb|ESR58145.1| hypothetical protein CICLE_v10019570mg [Citrus clementina] Length = 549 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = -1 Query: 296 SIPWTSFMADDSLYFINDILHLRAELTIK 210 +IPWTSFMADDSLYFIN ILHLRAELTI+ Sbjct: 520 AIPWTSFMADDSLYFINGILHLRAELTIR 548 >ref|XP_006402466.1| hypothetical protein EUTSA_v10005840mg [Eutrema salsugineum] gi|557103565|gb|ESQ43919.1| hypothetical protein EUTSA_v10005840mg [Eutrema salsugineum] Length = 613 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = -1 Query: 293 IPWTSFMADDSLYFINDILHLRAELTIKR 207 IPWTSF+A+DSLYFIN ILHLRAELTIKR Sbjct: 580 IPWTSFIAEDSLYFINGILHLRAELTIKR 608 >ref|XP_006402465.1| hypothetical protein EUTSA_v10005840mg [Eutrema salsugineum] gi|557103564|gb|ESQ43918.1| hypothetical protein EUTSA_v10005840mg [Eutrema salsugineum] Length = 603 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = -1 Query: 293 IPWTSFMADDSLYFINDILHLRAELTIKR 207 IPWTSF+A+DSLYFIN ILHLRAELTIKR Sbjct: 570 IPWTSFIAEDSLYFINGILHLRAELTIKR 598 >ref|XP_002511951.1| atpob1, putative [Ricinus communis] gi|223549131|gb|EEF50620.1| atpob1, putative [Ricinus communis] Length = 549 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = -1 Query: 296 SIPWTSFMADDSLYFINDILHLRAELTIK 210 +IPWTSFMADDSLYFIN +LHLRAELTI+ Sbjct: 520 AIPWTSFMADDSLYFINGVLHLRAELTIR 548 >ref|XP_003548592.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Glycine max] Length = 553 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = -1 Query: 296 SIPWTSFMADDSLYFINDILHLRAELTIK 210 +IPWTSFMA+DSLYFIN +LHLRAELTIK Sbjct: 524 AIPWTSFMAEDSLYFINGVLHLRAELTIK 552 >ref|XP_003528818.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Glycine max] Length = 550 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = -1 Query: 296 SIPWTSFMADDSLYFINDILHLRAELTIK 210 +IPWTSFMA+DSLYFIN +LHLRAELTIK Sbjct: 521 AIPWTSFMAEDSLYFINGVLHLRAELTIK 549 >ref|XP_007051653.1| POZ/BTB containin G-protein 1 isoform 6 [Theobroma cacao] gi|508703914|gb|EOX95810.1| POZ/BTB containin G-protein 1 isoform 6 [Theobroma cacao] Length = 525 Score = 56.6 bits (135), Expect = 4e-06 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = -1 Query: 296 SIPWTSFMADDSLYFINDILHLRAELTIKR 207 +IPWTSFMA+DSLYFIN ILHLRAELTI++ Sbjct: 496 AIPWTSFMAEDSLYFINGILHLRAELTIRQ 525 >ref|XP_007051652.1| POZ/BTB containin G-protein 1 isoform 5 [Theobroma cacao] gi|508703913|gb|EOX95809.1| POZ/BTB containin G-protein 1 isoform 5 [Theobroma cacao] Length = 380 Score = 56.6 bits (135), Expect = 4e-06 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = -1 Query: 296 SIPWTSFMADDSLYFINDILHLRAELTIKR 207 +IPWTSFMA+DSLYFIN ILHLRAELTI++ Sbjct: 351 AIPWTSFMAEDSLYFINGILHLRAELTIRQ 380 >ref|XP_007051651.1| POZ/BTB containin G-protein 1 isoform 4 [Theobroma cacao] gi|508703912|gb|EOX95808.1| POZ/BTB containin G-protein 1 isoform 4 [Theobroma cacao] Length = 413 Score = 56.6 bits (135), Expect = 4e-06 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = -1 Query: 296 SIPWTSFMADDSLYFINDILHLRAELTIKR 207 +IPWTSFMA+DSLYFIN ILHLRAELTI++ Sbjct: 384 AIPWTSFMAEDSLYFINGILHLRAELTIRQ 413 >ref|XP_007051650.1| POZ/BTB containin G-protein 1 isoform 3 [Theobroma cacao] gi|508703911|gb|EOX95807.1| POZ/BTB containin G-protein 1 isoform 3 [Theobroma cacao] Length = 468 Score = 56.6 bits (135), Expect = 4e-06 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = -1 Query: 296 SIPWTSFMADDSLYFINDILHLRAELTIKR 207 +IPWTSFMA+DSLYFIN ILHLRAELTI++ Sbjct: 439 AIPWTSFMAEDSLYFINGILHLRAELTIRQ 468 >ref|XP_007051649.1| POZ/BTB containin G-protein 1 isoform 2 [Theobroma cacao] gi|508703910|gb|EOX95806.1| POZ/BTB containin G-protein 1 isoform 2 [Theobroma cacao] Length = 460 Score = 56.6 bits (135), Expect = 4e-06 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = -1 Query: 296 SIPWTSFMADDSLYFINDILHLRAELTIKR 207 +IPWTSFMA+DSLYFIN ILHLRAELTI++ Sbjct: 431 AIPWTSFMAEDSLYFINGILHLRAELTIRQ 460 >ref|XP_007051648.1| POZ/BTB containin G-protein 1 isoform 1 [Theobroma cacao] gi|508703909|gb|EOX95805.1| POZ/BTB containin G-protein 1 isoform 1 [Theobroma cacao] Length = 552 Score = 56.6 bits (135), Expect = 4e-06 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = -1 Query: 296 SIPWTSFMADDSLYFINDILHLRAELTIKR 207 +IPWTSFMA+DSLYFIN ILHLRAELTI++ Sbjct: 523 AIPWTSFMAEDSLYFINGILHLRAELTIRQ 552 >ref|XP_006293934.1| hypothetical protein CARUB_v10022924mg [Capsella rubella] gi|482562642|gb|EOA26832.1| hypothetical protein CARUB_v10022924mg [Capsella rubella] Length = 560 Score = 56.6 bits (135), Expect = 4e-06 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = -1 Query: 293 IPWTSFMADDSLYFINDILHLRAELTIKR 207 +PWTSFMA+DSL+FIN ILHLRAELTIKR Sbjct: 527 VPWTSFMAEDSLHFINGILHLRAELTIKR 555 >ref|XP_006293933.1| hypothetical protein CARUB_v10022924mg [Capsella rubella] gi|482562641|gb|EOA26831.1| hypothetical protein CARUB_v10022924mg [Capsella rubella] Length = 453 Score = 56.6 bits (135), Expect = 4e-06 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = -1 Query: 293 IPWTSFMADDSLYFINDILHLRAELTIKR 207 +PWTSFMA+DSL+FIN ILHLRAELTIKR Sbjct: 420 VPWTSFMAEDSLHFINGILHLRAELTIKR 448 >ref|XP_004306705.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Fragaria vesca subsp. vesca] Length = 557 Score = 56.2 bits (134), Expect = 5e-06 Identities = 24/29 (82%), Positives = 28/29 (96%) Frame = -1 Query: 296 SIPWTSFMADDSLYFINDILHLRAELTIK 210 +IPWT+FMADDSLYFIN +LHLRAELTI+ Sbjct: 528 AIPWTNFMADDSLYFINGVLHLRAELTIR 556 >ref|XP_007135186.1| hypothetical protein PHAVU_010G108200g [Phaseolus vulgaris] gi|561008231|gb|ESW07180.1| hypothetical protein PHAVU_010G108200g [Phaseolus vulgaris] Length = 550 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/29 (82%), Positives = 28/29 (96%) Frame = -1 Query: 296 SIPWTSFMADDSLYFINDILHLRAELTIK 210 +IPWTSFMA+DSLYFIN +LHLRAELTI+ Sbjct: 521 AIPWTSFMAEDSLYFINGVLHLRAELTIR 549 >ref|XP_007135185.1| hypothetical protein PHAVU_010G108100g [Phaseolus vulgaris] gi|561008230|gb|ESW07179.1| hypothetical protein PHAVU_010G108100g [Phaseolus vulgaris] Length = 551 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/29 (82%), Positives = 28/29 (96%) Frame = -1 Query: 296 SIPWTSFMADDSLYFINDILHLRAELTIK 210 +IPWTSFMA+DSLYFIN +LHLRAELTI+ Sbjct: 522 AIPWTSFMAEDSLYFINGVLHLRAELTIR 550 >ref|XP_002320175.2| BTB/POZ domain-containing family protein [Populus trichocarpa] gi|550323798|gb|EEE98490.2| BTB/POZ domain-containing family protein [Populus trichocarpa] Length = 548 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/29 (82%), Positives = 28/29 (96%) Frame = -1 Query: 296 SIPWTSFMADDSLYFINDILHLRAELTIK 210 +IPWTSFMA+DSLYFIN +LHLRAELTI+ Sbjct: 519 AIPWTSFMAEDSLYFINGVLHLRAELTIR 547