BLASTX nr result
ID: Mentha26_contig00012661
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00012661 (583 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU45462.1| hypothetical protein MIMGU_mgv1a004651mg [Mimulus... 79 1e-12 gb|EYU38183.1| hypothetical protein MIMGU_mgv1a004749mg [Mimulus... 79 1e-12 emb|CBI26002.3| unnamed protein product [Vitis vinifera] 67 3e-09 ref|XP_002274904.1| PREDICTED: pentatricopeptide repeat-containi... 67 3e-09 emb|CAN74604.1| hypothetical protein VITISV_025315 [Vitis vinifera] 63 5e-08 gb|AFK48661.1| unknown [Lotus japonicus] 60 4e-07 ref|XP_004508090.1| PREDICTED: pentatricopeptide repeat-containi... 59 1e-06 ref|XP_003577908.1| PREDICTED: pentatricopeptide repeat-containi... 59 1e-06 ref|XP_002519315.1| pentatricopeptide repeat-containing protein,... 58 2e-06 ref|XP_003550954.1| PREDICTED: pentatricopeptide repeat-containi... 58 2e-06 ref|XP_006600379.1| PREDICTED: pentatricopeptide repeat-containi... 58 2e-06 ref|XP_002311357.2| hypothetical protein POPTR_0008s09820g [Popu... 57 3e-06 ref|XP_002316075.2| hypothetical protein POPTR_0010s16360g [Popu... 57 4e-06 ref|XP_004252946.1| PREDICTED: pentatricopeptide repeat-containi... 56 6e-06 ref|XP_006349961.1| PREDICTED: pentatricopeptide repeat-containi... 56 8e-06 ref|XP_004229043.1| PREDICTED: pentatricopeptide repeat-containi... 56 8e-06 >gb|EYU45462.1| hypothetical protein MIMGU_mgv1a004651mg [Mimulus guttatus] Length = 516 Score = 78.6 bits (192), Expect = 1e-12 Identities = 40/60 (66%), Positives = 48/60 (80%), Gaps = 1/60 (1%) Frame = +3 Query: 6 CKPDSTTYSIMMDAYRKEGMTDKVYDLEQEMERMI-TKVPNGVDFGETEDSSDVNEVLSV 182 C+PDSTTYS+MMDAYRKEGM+DKVYDLEQEM+RM KV G D ETE + DV++ + V Sbjct: 455 CQPDSTTYSVMMDAYRKEGMSDKVYDLEQEMQRMNGGKVSKGYDDVETEANDDVSKEVLV 514 >gb|EYU38183.1| hypothetical protein MIMGU_mgv1a004749mg [Mimulus guttatus] Length = 512 Score = 78.6 bits (192), Expect = 1e-12 Identities = 40/60 (66%), Positives = 48/60 (80%), Gaps = 1/60 (1%) Frame = +3 Query: 6 CKPDSTTYSIMMDAYRKEGMTDKVYDLEQEMERMI-TKVPNGVDFGETEDSSDVNEVLSV 182 C+PDSTTYS+MMDAYRKEGM+DKVYDLEQEM+RM KV G D ETE + DV++ + V Sbjct: 451 CQPDSTTYSVMMDAYRKEGMSDKVYDLEQEMQRMNGGKVSKGYDDVETEANDDVSKEVLV 510 >emb|CBI26002.3| unnamed protein product [Vitis vinifera] Length = 469 Score = 67.4 bits (163), Expect = 3e-09 Identities = 28/41 (68%), Positives = 35/41 (85%) Frame = +3 Query: 6 CKPDSTTYSIMMDAYRKEGMTDKVYDLEQEMERMITKVPNG 128 C+PDSTTYSIM++AY+KEGM DK+YDLEQE +RM+ P G Sbjct: 428 CQPDSTTYSIMVEAYKKEGMNDKIYDLEQERQRMVADGPKG 468 >ref|XP_002274904.1| PREDICTED: pentatricopeptide repeat-containing protein At3g06430, chloroplastic [Vitis vinifera] Length = 498 Score = 67.4 bits (163), Expect = 3e-09 Identities = 28/41 (68%), Positives = 35/41 (85%) Frame = +3 Query: 6 CKPDSTTYSIMMDAYRKEGMTDKVYDLEQEMERMITKVPNG 128 C+PDSTTYSIM++AY+KEGM DK+YDLEQE +RM+ P G Sbjct: 457 CQPDSTTYSIMVEAYKKEGMNDKIYDLEQERQRMVADGPKG 497 >emb|CAN74604.1| hypothetical protein VITISV_025315 [Vitis vinifera] Length = 525 Score = 63.2 bits (152), Expect = 5e-08 Identities = 26/35 (74%), Positives = 33/35 (94%) Frame = +3 Query: 6 CKPDSTTYSIMMDAYRKEGMTDKVYDLEQEMERMI 110 C+PDSTTYSIM++AY+KEGM DK+YDLEQE +RM+ Sbjct: 457 CQPDSTTYSIMVEAYKKEGMNDKIYDLEQERQRMM 491 >gb|AFK48661.1| unknown [Lotus japonicus] Length = 266 Score = 60.1 bits (144), Expect = 4e-07 Identities = 28/49 (57%), Positives = 36/49 (73%) Frame = +3 Query: 6 CKPDSTTYSIMMDAYRKEGMTDKVYDLEQEMERMITKVPNGVDFGETED 152 C PD TTY+IM++AYRKEGM DK+Y LEQE + MIT +G+ + ED Sbjct: 217 CPPDDTTYTIMIEAYRKEGMNDKIYYLEQEKKTMIT---DGIKVSQPED 262 >ref|XP_004508090.1| PREDICTED: pentatricopeptide repeat-containing protein At3g06430, chloroplastic-like [Cicer arietinum] Length = 499 Score = 58.5 bits (140), Expect = 1e-06 Identities = 25/36 (69%), Positives = 32/36 (88%) Frame = +3 Query: 6 CKPDSTTYSIMMDAYRKEGMTDKVYDLEQEMERMIT 113 C+PD+TTYSIM+ AYRK+GM+DK+Y LEQE + MIT Sbjct: 450 CQPDNTTYSIMVKAYRKQGMSDKIYYLEQEKQTMIT 485 >ref|XP_003577908.1| PREDICTED: pentatricopeptide repeat-containing protein At3g06430, chloroplastic-like [Brachypodium distachyon] Length = 512 Score = 58.5 bits (140), Expect = 1e-06 Identities = 24/36 (66%), Positives = 32/36 (88%) Frame = +3 Query: 6 CKPDSTTYSIMMDAYRKEGMTDKVYDLEQEMERMIT 113 C PD+TTYSI+++AYRKEGMTDKVYDL+QE +++ Sbjct: 471 CAPDATTYSILVEAYRKEGMTDKVYDLQQENPSLVS 506 >ref|XP_002519315.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223541630|gb|EEF43179.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 491 Score = 58.2 bits (139), Expect = 2e-06 Identities = 25/38 (65%), Positives = 32/38 (84%) Frame = +3 Query: 6 CKPDSTTYSIMMDAYRKEGMTDKVYDLEQEMERMITKV 119 C+PDSTTYSIM++AY++EGM DKVY LEQE + M+ V Sbjct: 443 CQPDSTTYSIMVEAYKREGMNDKVYYLEQEKQGMVAHV 480 >ref|XP_003550954.1| PREDICTED: pentatricopeptide repeat-containing protein At3g06430, chloroplastic-like [Glycine max] Length = 488 Score = 57.8 bits (138), Expect = 2e-06 Identities = 24/36 (66%), Positives = 31/36 (86%) Frame = +3 Query: 6 CKPDSTTYSIMMDAYRKEGMTDKVYDLEQEMERMIT 113 C+PD TTY+IM++AYRKEGM DK+Y LEQE + M+T Sbjct: 439 CQPDDTTYTIMIEAYRKEGMNDKIYYLEQEKQTMMT 474 >ref|XP_006600379.1| PREDICTED: pentatricopeptide repeat-containing protein At3g06430, chloroplastic-like [Glycine max] Length = 488 Score = 57.8 bits (138), Expect = 2e-06 Identities = 24/36 (66%), Positives = 31/36 (86%) Frame = +3 Query: 6 CKPDSTTYSIMMDAYRKEGMTDKVYDLEQEMERMIT 113 C+PD TTY+IM++AYRKEGM DK+Y LEQE + M+T Sbjct: 439 CQPDDTTYTIMIEAYRKEGMNDKIYYLEQEKQTMMT 474 >ref|XP_002311357.2| hypothetical protein POPTR_0008s09820g [Populus trichocarpa] gi|550332748|gb|EEE88724.2| hypothetical protein POPTR_0008s09820g [Populus trichocarpa] Length = 445 Score = 57.4 bits (137), Expect = 3e-06 Identities = 25/35 (71%), Positives = 30/35 (85%) Frame = +3 Query: 6 CKPDSTTYSIMMDAYRKEGMTDKVYDLEQEMERMI 110 C PDS TYSIM++AYRKEGM DK+Y LEQE ++MI Sbjct: 404 CLPDSRTYSIMVEAYRKEGMNDKIYYLEQEKQKMI 438 >ref|XP_002316075.2| hypothetical protein POPTR_0010s16360g [Populus trichocarpa] gi|550329937|gb|EEF02246.2| hypothetical protein POPTR_0010s16360g [Populus trichocarpa] Length = 487 Score = 57.0 bits (136), Expect = 4e-06 Identities = 25/35 (71%), Positives = 29/35 (82%) Frame = +3 Query: 6 CKPDSTTYSIMMDAYRKEGMTDKVYDLEQEMERMI 110 C PDS TYSIM++AYRKEGM DK+Y LEQE + MI Sbjct: 447 CPPDSRTYSIMVEAYRKEGMNDKIYYLEQEKQEMI 481 >ref|XP_004252946.1| PREDICTED: pentatricopeptide repeat-containing protein At3g06430, chloroplastic-like [Solanum lycopersicum] Length = 495 Score = 56.2 bits (134), Expect = 6e-06 Identities = 24/33 (72%), Positives = 28/33 (84%) Frame = +3 Query: 9 KPDSTTYSIMMDAYRKEGMTDKVYDLEQEMERM 107 +PD TTY++M +AYRKEGMTDKVYDLEQE M Sbjct: 446 RPDDTTYTVMAEAYRKEGMTDKVYDLEQEKRMM 478 >ref|XP_006349961.1| PREDICTED: pentatricopeptide repeat-containing protein At3g06430, chloroplastic-like [Solanum tuberosum] Length = 495 Score = 55.8 bits (133), Expect = 8e-06 Identities = 24/33 (72%), Positives = 28/33 (84%) Frame = +3 Query: 9 KPDSTTYSIMMDAYRKEGMTDKVYDLEQEMERM 107 +PD TTY++M +AYRKEGMTDKVYDLEQE M Sbjct: 446 QPDDTTYTVMAEAYRKEGMTDKVYDLEQEKRMM 478 >ref|XP_004229043.1| PREDICTED: pentatricopeptide repeat-containing protein At3g06430, chloroplastic-like [Solanum lycopersicum] Length = 499 Score = 55.8 bits (133), Expect = 8e-06 Identities = 26/41 (63%), Positives = 30/41 (73%) Frame = +3 Query: 6 CKPDSTTYSIMMDAYRKEGMTDKVYDLEQEMERMITKVPNG 128 C+PD TYS M+DAY+KEGMTDKVYDLEQE + NG Sbjct: 446 CQPDLMTYSTMIDAYQKEGMTDKVYDLEQEKLLKVAIHSNG 486