BLASTX nr result
ID: Mentha26_contig00012597
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00012597 (329 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADQ57386.1| CSP41A-X protein [Silene latifolia] 59 9e-07 gb|EXB39373.1| hypothetical protein L484_025068 [Morus notabilis] 58 1e-06 ref|XP_003518924.1| PREDICTED: chloroplast stem-loop binding pro... 58 1e-06 gb|ADQ57387.1| CSP41A-Y protein [Silene latifolia] 58 1e-06 gb|ACU24035.1| unknown [Glycine max] 58 1e-06 ref|XP_003590650.1| MRNA-binding protein [Medicago truncatula] g... 57 2e-06 ref|XP_003590649.1| MRNA-binding protein [Medicago truncatula] g... 57 2e-06 ref|XP_007144635.1| hypothetical protein PHAVU_007G172100g [Phas... 57 3e-06 gb|ADQ57385.1| CSP41A protein [Silene vulgaris] 57 3e-06 ref|XP_003536518.1| PREDICTED: chloroplast stem-loop binding pro... 57 4e-06 ref|XP_006349675.1| PREDICTED: chloroplast stem-loop binding pro... 56 5e-06 ref|NP_001234656.1| mRNA binding protein precursor [Solanum lyco... 56 5e-06 ref|XP_004495202.1| PREDICTED: chloroplast stem-loop binding pro... 56 6e-06 ref|XP_007199894.1| hypothetical protein PRUPE_ppa006606mg [Prun... 56 6e-06 ref|NP_191873.1| chloroplast stem-loop binding protein-41 [Arabi... 55 8e-06 ref|XP_002878498.1| hypothetical protein ARALYDRAFT_486816 [Arab... 55 8e-06 >gb|ADQ57386.1| CSP41A-X protein [Silene latifolia] Length = 306 Score = 58.5 bits (140), Expect = 9e-07 Identities = 27/32 (84%), Positives = 28/32 (87%) Frame = +3 Query: 3 YEEYVKIGRDKKDIKFELDDKIIAALKVPVTV 98 YEEYVKIGRDKKDIKFELDDKI+ ALK P V Sbjct: 275 YEEYVKIGRDKKDIKFELDDKILEALKAPAAV 306 >gb|EXB39373.1| hypothetical protein L484_025068 [Morus notabilis] Length = 408 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +3 Query: 3 YEEYVKIGRDKKDIKFELDDKIIAALKVPV 92 +EEYVKIGRDKKDIKFELDDKI+ ALKVPV Sbjct: 377 FEEYVKIGRDKKDIKFELDDKILDALKVPV 406 >ref|XP_003518924.1| PREDICTED: chloroplast stem-loop binding protein of 41 kDa a, chloroplastic-like [Glycine max] Length = 403 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = +3 Query: 3 YEEYVKIGRDKKDIKFELDDKIIAALKVPVTV 98 +EEYVKIGRDKK I+FELDDKI+ ALKVPVTV Sbjct: 372 FEEYVKIGRDKKSIQFELDDKILEALKVPVTV 403 >gb|ADQ57387.1| CSP41A-Y protein [Silene latifolia] Length = 306 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/32 (84%), Positives = 28/32 (87%) Frame = +3 Query: 3 YEEYVKIGRDKKDIKFELDDKIIAALKVPVTV 98 YEEYVKIGRDKKDIKFELDDKI+ ALK P V Sbjct: 275 YEEYVKIGRDKKDIKFELDDKILDALKAPAAV 306 >gb|ACU24035.1| unknown [Glycine max] Length = 403 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = +3 Query: 3 YEEYVKIGRDKKDIKFELDDKIIAALKVPVTV 98 +EEYVKIGRDKK I+FELDDKI+ ALKVPVTV Sbjct: 372 FEEYVKIGRDKKSIQFELDDKILEALKVPVTV 403 >ref|XP_003590650.1| MRNA-binding protein [Medicago truncatula] gi|355479698|gb|AES60901.1| MRNA-binding protein [Medicago truncatula] Length = 419 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = +3 Query: 3 YEEYVKIGRDKKDIKFELDDKIIAALKVPVTV 98 +EEY+KIGRDKK IKFELDDKI+ ALKVPV+V Sbjct: 388 FEEYIKIGRDKKPIKFELDDKILEALKVPVSV 419 >ref|XP_003590649.1| MRNA-binding protein [Medicago truncatula] gi|355479697|gb|AES60900.1| MRNA-binding protein [Medicago truncatula] Length = 401 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = +3 Query: 3 YEEYVKIGRDKKDIKFELDDKIIAALKVPVTV 98 +EEY+KIGRDKK IKFELDDKI+ ALKVPV+V Sbjct: 370 FEEYIKIGRDKKPIKFELDDKILEALKVPVSV 401 >ref|XP_007144635.1| hypothetical protein PHAVU_007G172100g [Phaseolus vulgaris] gi|561017825|gb|ESW16629.1| hypothetical protein PHAVU_007G172100g [Phaseolus vulgaris] Length = 402 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = +3 Query: 3 YEEYVKIGRDKKDIKFELDDKIIAALKVPVTV 98 +EEYVKIGRDKK IKFE+DDKI+ ALKVPV+V Sbjct: 371 FEEYVKIGRDKKSIKFEVDDKILEALKVPVSV 402 >gb|ADQ57385.1| CSP41A protein [Silene vulgaris] Length = 306 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = +3 Query: 3 YEEYVKIGRDKKDIKFELDDKIIAALKVPVTV 98 Y+EYVKIGRDKKDIKFELDDKI+ ALK P V Sbjct: 275 YDEYVKIGRDKKDIKFELDDKILDALKAPAAV 306 >ref|XP_003536518.1| PREDICTED: chloroplast stem-loop binding protein of 41 kDa a, chloroplastic-like [Glycine max] Length = 404 Score = 56.6 bits (135), Expect = 4e-06 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = +3 Query: 3 YEEYVKIGRDKKDIKFELDDKIIAALKVPVTV 98 +EEYVKIGRDKK I+FELDDKI+ ALKVPV+V Sbjct: 373 FEEYVKIGRDKKSIQFELDDKILEALKVPVSV 404 >ref|XP_006349675.1| PREDICTED: chloroplast stem-loop binding protein of 41 kDa a, chloroplastic-like [Solanum tuberosum] Length = 401 Score = 56.2 bits (134), Expect = 5e-06 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = +3 Query: 3 YEEYVKIGRDKKDIKFELDDKIIAALKVPV 92 YEEYVKIGRDKK++KFELDDKI+ +LKVPV Sbjct: 370 YEEYVKIGRDKKEMKFELDDKILESLKVPV 399 >ref|NP_001234656.1| mRNA binding protein precursor [Solanum lycopersicum] gi|26453355|gb|AAD21574.3| mRNA binding protein precursor [Solanum lycopersicum] Length = 407 Score = 56.2 bits (134), Expect = 5e-06 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = +3 Query: 3 YEEYVKIGRDKKDIKFELDDKIIAALKVPV 92 YEEYVKIGRDKK++KFELDDKI+ +LKVPV Sbjct: 376 YEEYVKIGRDKKEMKFELDDKILESLKVPV 405 >ref|XP_004495202.1| PREDICTED: chloroplast stem-loop binding protein of 41 kDa a, chloroplastic-like [Cicer arietinum] Length = 403 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = +3 Query: 3 YEEYVKIGRDKKDIKFELDDKIIAALKVPVTV 98 +EEY+KIGRDKK IKFE+DDKI+ ALKVPV V Sbjct: 372 FEEYIKIGRDKKPIKFEVDDKILEALKVPVAV 403 >ref|XP_007199894.1| hypothetical protein PRUPE_ppa006606mg [Prunus persica] gi|462395294|gb|EMJ01093.1| hypothetical protein PRUPE_ppa006606mg [Prunus persica] Length = 403 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = +3 Query: 3 YEEYVKIGRDKKDIKFELDDKIIAALKVPVTV 98 +EEY+KIGRDKK IKFELDDKII +LKVPV V Sbjct: 372 FEEYLKIGRDKKTIKFELDDKIIESLKVPVAV 403 >ref|NP_191873.1| chloroplast stem-loop binding protein-41 [Arabidopsis thaliana] gi|75311698|sp|Q9LYA9.1|CP41A_ARATH RecName: Full=Chloroplast stem-loop binding protein of 41 kDa a, chloroplastic; Short=CSP41-a; Flags: Precursor gi|16226201|gb|AAL16101.1|AF428269_1 AT3g63140/T20O10_240 [Arabidopsis thaliana] gi|7573443|emb|CAB87759.1| mRNA binding protein precursor-like [Arabidopsis thaliana] gi|16649035|gb|AAL24369.1| mRNA binding protein precursor-like [Arabidopsis thaliana] gi|22136252|gb|AAM91204.1| mRNA binding protein precursor-like [Arabidopsis thaliana] gi|332646919|gb|AEE80440.1| chloroplast stem-loop binding protein-41 [Arabidopsis thaliana] Length = 406 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +3 Query: 3 YEEYVKIGRDKKDIKFELDDKIIAALKVPV 92 +EEYVKIGRDKK+IKFELDDKI+ ALK PV Sbjct: 375 FEEYVKIGRDKKEIKFELDDKILEALKTPV 404 >ref|XP_002878498.1| hypothetical protein ARALYDRAFT_486816 [Arabidopsis lyrata subsp. lyrata] gi|297324336|gb|EFH54757.1| hypothetical protein ARALYDRAFT_486816 [Arabidopsis lyrata subsp. lyrata] Length = 408 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +3 Query: 3 YEEYVKIGRDKKDIKFELDDKIIAALKVPV 92 +EEYVKIGRDKK+IKFELDDKI+ ALK PV Sbjct: 377 FEEYVKIGRDKKEIKFELDDKILEALKTPV 406