BLASTX nr result
ID: Mentha26_contig00011660
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00011660 (464 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU42028.1| hypothetical protein MIMGU_mgv1a008251mg [Mimulus... 60 2e-07 gb|EYU42027.1| hypothetical protein MIMGU_mgv1a008251mg [Mimulus... 60 2e-07 ref|XP_004246287.1| PREDICTED: uncharacterized protein LOC101261... 56 6e-06 >gb|EYU42028.1| hypothetical protein MIMGU_mgv1a008251mg [Mimulus guttatus] Length = 378 Score = 60.5 bits (145), Expect = 2e-07 Identities = 31/45 (68%), Positives = 35/45 (77%) Frame = -1 Query: 461 LFLRELHVVSMRPFISNFFTTLISGGVVAFYLYRIIRDREQAGGS 327 LF+REL MRPF +N FTT ISGGVVAFYLYRII+D Q+G S Sbjct: 329 LFVRELR---MRPFTANIFTTFISGGVVAFYLYRIIKDGGQSGAS 370 >gb|EYU42027.1| hypothetical protein MIMGU_mgv1a008251mg [Mimulus guttatus] Length = 379 Score = 60.5 bits (145), Expect = 2e-07 Identities = 31/45 (68%), Positives = 35/45 (77%) Frame = -1 Query: 461 LFLRELHVVSMRPFISNFFTTLISGGVVAFYLYRIIRDREQAGGS 327 LF+REL MRPF +N FTT ISGGVVAFYLYRII+D Q+G S Sbjct: 330 LFVRELR---MRPFTANIFTTFISGGVVAFYLYRIIKDGGQSGAS 371 >ref|XP_004246287.1| PREDICTED: uncharacterized protein LOC101261442 [Solanum lycopersicum] Length = 311 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/45 (57%), Positives = 31/45 (68%) Frame = -1 Query: 461 LFLRELHVVSMRPFISNFFTTLISGGVVAFYLYRIIRDREQAGGS 327 LF+RE ++ +PFI NF T ISGGV AFY YRI+ D EQ GS Sbjct: 259 LFVREFRLMLQKPFIFNFITATISGGVAAFYAYRILMDGEQTKGS 303