BLASTX nr result
ID: Mentha26_contig00011283
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00011283 (412 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU38441.1| hypothetical protein MIMGU_mgv1a011446mg [Mimulus... 55 8e-06 >gb|EYU38441.1| hypothetical protein MIMGU_mgv1a011446mg [Mimulus guttatus] Length = 281 Score = 55.5 bits (132), Expect = 8e-06 Identities = 27/43 (62%), Positives = 33/43 (76%), Gaps = 1/43 (2%) Frame = +1 Query: 286 LQFYNHSIDQYESDLVMVVKSLILSISETYQVEKAEAC-DASC 411 + Y +DQYE DL MVVKSLILSISET Q+EK +AC ++SC Sbjct: 76 ISMYKQPVDQYERDLTMVVKSLILSISETSQIEKPDACINSSC 118