BLASTX nr result
ID: Mentha26_contig00011204
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00011204 (359 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU19533.1| hypothetical protein MIMGU_mgv1a014048mg [Mimulus... 63 5e-08 ref|XP_004249010.1| PREDICTED: ADP-ribosylation factor-related p... 62 6e-08 ref|XP_007038654.1| GTP-binding protein 1 isoform 2 [Theobroma c... 62 8e-08 ref|XP_007038653.1| GTP-binding protein 1 isoform 1 [Theobroma c... 62 8e-08 gb|EPS69351.1| hypothetical protein M569_05414 [Genlisea aurea] 62 1e-07 ref|XP_007218423.1| hypothetical protein PRUPE_ppa011585mg [Prun... 55 8e-06 gb|ABK25781.1| unknown [Picea sitchensis] 55 8e-06 >gb|EYU19533.1| hypothetical protein MIMGU_mgv1a014048mg [Mimulus guttatus] gi|604299691|gb|EYU19534.1| hypothetical protein MIMGU_mgv1a014048mg [Mimulus guttatus] Length = 202 Score = 62.8 bits (151), Expect = 5e-08 Identities = 30/39 (76%), Positives = 35/39 (89%) Frame = -2 Query: 358 AVSAFDGVGIKEGVNWLVDAMGRSKRTETLRLRAGSNVV 242 AVSA DG+GIKE VNWLVD+M RSKRT+ LR+RAGS+VV Sbjct: 164 AVSAIDGLGIKESVNWLVDSMERSKRTDLLRVRAGSSVV 202 >ref|XP_004249010.1| PREDICTED: ADP-ribosylation factor-related protein 1-like [Solanum lycopersicum] gi|565399551|ref|XP_006365313.1| PREDICTED: ADP-ribosylation factor-related protein 1-like [Solanum tuberosum] Length = 204 Score = 62.4 bits (150), Expect = 6e-08 Identities = 28/39 (71%), Positives = 35/39 (89%) Frame = -2 Query: 358 AVSAFDGVGIKEGVNWLVDAMGRSKRTETLRLRAGSNVV 242 AVS++DG+GIKE VNWLVD M RSKRTE L+LRAG+N++ Sbjct: 164 AVSSYDGLGIKESVNWLVDVMERSKRTEMLQLRAGANLI 202 >ref|XP_007038654.1| GTP-binding protein 1 isoform 2 [Theobroma cacao] gi|590672591|ref|XP_007038655.1| GTP-binding protein 1 isoform 2 [Theobroma cacao] gi|508775899|gb|EOY23155.1| GTP-binding protein 1 isoform 2 [Theobroma cacao] gi|508775900|gb|EOY23156.1| GTP-binding protein 1 isoform 2 [Theobroma cacao] Length = 203 Score = 62.0 bits (149), Expect = 8e-08 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = -2 Query: 358 AVSAFDGVGIKEGVNWLVDAMGRSKRTETLRLRAG 254 AVSAFDG+GIKEGV WLV+ M RSKRTETLR+RAG Sbjct: 164 AVSAFDGMGIKEGVEWLVEVMERSKRTETLRIRAG 198 >ref|XP_007038653.1| GTP-binding protein 1 isoform 1 [Theobroma cacao] gi|508775898|gb|EOY23154.1| GTP-binding protein 1 isoform 1 [Theobroma cacao] Length = 248 Score = 62.0 bits (149), Expect = 8e-08 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = -2 Query: 358 AVSAFDGVGIKEGVNWLVDAMGRSKRTETLRLRAG 254 AVSAFDG+GIKEGV WLV+ M RSKRTETLR+RAG Sbjct: 209 AVSAFDGMGIKEGVEWLVEVMERSKRTETLRIRAG 243 >gb|EPS69351.1| hypothetical protein M569_05414 [Genlisea aurea] Length = 202 Score = 61.6 bits (148), Expect = 1e-07 Identities = 30/39 (76%), Positives = 34/39 (87%) Frame = -2 Query: 358 AVSAFDGVGIKEGVNWLVDAMGRSKRTETLRLRAGSNVV 242 AVSA DG GIKE VNW+V+AM RSKRTE LRLRAGS++V Sbjct: 164 AVSAIDGRGIKESVNWIVNAMERSKRTELLRLRAGSSIV 202 >ref|XP_007218423.1| hypothetical protein PRUPE_ppa011585mg [Prunus persica] gi|462414885|gb|EMJ19622.1| hypothetical protein PRUPE_ppa011585mg [Prunus persica] Length = 205 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/36 (72%), Positives = 30/36 (83%) Frame = -2 Query: 358 AVSAFDGVGIKEGVNWLVDAMGRSKRTETLRLRAGS 251 AVSA+DG+GIKE V WLV+ M RSKRTE LR RAG+ Sbjct: 164 AVSAYDGMGIKESVEWLVEVMERSKRTEMLRARAGA 199 >gb|ABK25781.1| unknown [Picea sitchensis] Length = 203 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = -2 Query: 358 AVSAFDGVGIKEGVNWLVDAMGRSKRTETLRLRA 257 A+SA+DG+GIK+G+NWLVDAM RSKR E LR RA Sbjct: 164 AISAYDGLGIKDGINWLVDAMERSKRFELLRQRA 197