BLASTX nr result
ID: Mentha26_contig00010841
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00010841 (312 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004159743.1| PREDICTED: uncharacterized transporter YBR28... 59 7e-07 ref|XP_004146179.1| PREDICTED: LOW QUALITY PROTEIN: uncharacteri... 59 7e-07 ref|XP_004146180.1| PREDICTED: uncharacterized transporter YBR28... 56 5e-06 ref|XP_004159761.1| PREDICTED: uncharacterized transporter YBR28... 55 8e-06 ref|XP_004146216.1| PREDICTED: uncharacterized transporter YBR28... 55 8e-06 >ref|XP_004159743.1| PREDICTED: uncharacterized transporter YBR287W-like [Cucumis sativus] Length = 412 Score = 58.9 bits (141), Expect = 7e-07 Identities = 28/36 (77%), Positives = 32/36 (88%) Frame = +3 Query: 198 MGLLSLLEVSLMPILQVLLLCLLGAFMATDYLNLFP 305 MGLLSLLEV+LMP LQVLL+CL+GA +ATDY NL P Sbjct: 1 MGLLSLLEVALMPNLQVLLICLVGALLATDYCNLLP 36 >ref|XP_004146179.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized transporter YBR287W-like [Cucumis sativus] Length = 420 Score = 58.9 bits (141), Expect = 7e-07 Identities = 28/36 (77%), Positives = 32/36 (88%) Frame = +3 Query: 198 MGLLSLLEVSLMPILQVLLLCLLGAFMATDYLNLFP 305 MGLLSLLEV+LMP LQVLL+CL+GA +ATDY NL P Sbjct: 1 MGLLSLLEVALMPNLQVLLICLVGALLATDYCNLLP 36 >ref|XP_004146180.1| PREDICTED: uncharacterized transporter YBR287W-like [Cucumis sativus] gi|449495139|ref|XP_004159745.1| PREDICTED: uncharacterized transporter YBR287W-like [Cucumis sativus] Length = 434 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/37 (70%), Positives = 32/37 (86%) Frame = +3 Query: 198 MGLLSLLEVSLMPILQVLLLCLLGAFMATDYLNLFPP 308 MGLLSLLEV+ MP +Q+LL+ LLGAF+ATDY N+ PP Sbjct: 1 MGLLSLLEVASMPNIQLLLISLLGAFLATDYCNILPP 37 >ref|XP_004159761.1| PREDICTED: uncharacterized transporter YBR287W-like [Cucumis sativus] Length = 395 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = +3 Query: 198 MGLLSLLEVSLMPILQVLLLCLLGAFMATDYLNLFP 305 MGLLSLLEV+ +P LQVLL+C +GAF+ATDY NL P Sbjct: 1 MGLLSLLEVAFIPNLQVLLMCSVGAFLATDYSNLLP 36 >ref|XP_004146216.1| PREDICTED: uncharacterized transporter YBR287W-like [Cucumis sativus] Length = 395 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = +3 Query: 198 MGLLSLLEVSLMPILQVLLLCLLGAFMATDYLNLFP 305 MGLLSLLEV+ +P LQVLL+C +GAF+ATDY NL P Sbjct: 1 MGLLSLLEVAFIPNLQVLLMCSVGAFLATDYSNLLP 36