BLASTX nr result
ID: Mentha26_contig00010810
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00010810 (360 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU34724.1| hypothetical protein MIMGU_mgv1a011756mg [Mimulus... 64 3e-08 ref|XP_006399979.1| hypothetical protein EUTSA_v10014367mg [Eutr... 57 4e-06 >gb|EYU34724.1| hypothetical protein MIMGU_mgv1a011756mg [Mimulus guttatus] Length = 271 Score = 63.5 bits (153), Expect = 3e-08 Identities = 30/42 (71%), Positives = 36/42 (85%) Frame = +2 Query: 2 SDEVLESIRIKLHDLEKKYEARTGLPSPEKIDERRSMKKAVG 127 SDE+L++IR +L LEKKYE RTGLPSPE+ID RR +KKAVG Sbjct: 226 SDEILDTIRAELQALEKKYEERTGLPSPERIDIRRKIKKAVG 267 >ref|XP_006399979.1| hypothetical protein EUTSA_v10014367mg [Eutrema salsugineum] gi|557101069|gb|ESQ41432.1| hypothetical protein EUTSA_v10014367mg [Eutrema salsugineum] Length = 273 Score = 56.6 bits (135), Expect = 4e-06 Identities = 26/42 (61%), Positives = 33/42 (78%) Frame = +2 Query: 2 SDEVLESIRIKLHDLEKKYEARTGLPSPEKIDERRSMKKAVG 127 +D+VL+SIR +L LEKKYE +TGLPSPE++ ERR K VG Sbjct: 228 TDQVLDSIREELEALEKKYEEKTGLPSPERVQERRKRKAGVG 269