BLASTX nr result
ID: Mentha26_contig00009951
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00009951 (408 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB77061.1| Peroxisomal membrane protein [Morus notabilis] 60 2e-07 ref|XP_006467409.1| PREDICTED: peroxisomal membrane protein PMP2... 60 3e-07 ref|XP_006449762.1| hypothetical protein CICLE_v10016857mg [Citr... 60 3e-07 gb|EYU27766.1| hypothetical protein MIMGU_mgv1a014579mg [Mimulus... 60 4e-07 emb|CBI23218.3| unnamed protein product [Vitis vinifera] 60 4e-07 ref|XP_002269336.1| PREDICTED: peroxisomal membrane protein PMP2... 60 4e-07 gb|EPS74437.1| hypothetical protein M569_00319, partial [Genlise... 59 7e-07 ref|XP_003573232.1| PREDICTED: peroxisomal membrane protein PMP2... 59 9e-07 ref|XP_006489679.1| PREDICTED: peroxisomal membrane protein PMP2... 58 2e-06 ref|XP_006420288.1| hypothetical protein CICLE_v10007209mg [Citr... 58 2e-06 ref|XP_003534581.1| PREDICTED: peroxisomal membrane protein PMP2... 58 2e-06 dbj|BAJ92860.1| predicted protein [Hordeum vulgare subsp. vulgare] 58 2e-06 dbj|BAJ86876.1| predicted protein [Hordeum vulgare subsp. vulgar... 58 2e-06 gb|ACU19135.1| unknown [Glycine max] 58 2e-06 ref|NP_001237804.1| uncharacterized protein LOC100499909 [Glycin... 58 2e-06 ref|XP_002285350.1| PREDICTED: peroxisomal membrane protein PMP2... 57 2e-06 emb|CAN76530.1| hypothetical protein VITISV_012682 [Vitis vinifera] 57 2e-06 gb|EYU33886.1| hypothetical protein MIMGU_mgv1a014552mg [Mimulus... 57 3e-06 ref|XP_006343281.1| PREDICTED: peroxisomal membrane protein PMP2... 57 3e-06 ref|XP_007147711.1| hypothetical protein PHAVU_006G148300g [Phas... 57 3e-06 >gb|EXB77061.1| Peroxisomal membrane protein [Morus notabilis] Length = 186 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/30 (86%), Positives = 30/30 (100%) Frame = +3 Query: 3 VAKKVVLEQLTISPWNNLMFMIYYGLVIEG 92 VAKKV+LEQLT+SPWNNL+FMIYYGLV+EG Sbjct: 88 VAKKVLLEQLTLSPWNNLLFMIYYGLVVEG 117 >ref|XP_006467409.1| PREDICTED: peroxisomal membrane protein PMP22-like [Citrus sinensis] Length = 182 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +3 Query: 3 VAKKVVLEQLTISPWNNLMFMIYYGLVIEG 92 VAKKVVLEQLT SPWNNLMFMIYYG+V+EG Sbjct: 88 VAKKVVLEQLTSSPWNNLMFMIYYGVVVEG 117 >ref|XP_006449762.1| hypothetical protein CICLE_v10016857mg [Citrus clementina] gi|557552373|gb|ESR63002.1| hypothetical protein CICLE_v10016857mg [Citrus clementina] Length = 186 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +3 Query: 3 VAKKVVLEQLTISPWNNLMFMIYYGLVIEG 92 VAKKVVLEQLT SPWNNLMFMIYYG+V+EG Sbjct: 88 VAKKVVLEQLTSSPWNNLMFMIYYGVVVEG 117 >gb|EYU27766.1| hypothetical protein MIMGU_mgv1a014579mg [Mimulus guttatus] Length = 185 Score = 59.7 bits (143), Expect = 4e-07 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +3 Query: 3 VAKKVVLEQLTISPWNNLMFMIYYGLVIEG 92 VAKKVVLEQLT SPWNN++FMIYYGLVIEG Sbjct: 88 VAKKVVLEQLTSSPWNNMLFMIYYGLVIEG 117 >emb|CBI23218.3| unnamed protein product [Vitis vinifera] Length = 231 Score = 59.7 bits (143), Expect = 4e-07 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = +3 Query: 3 VAKKVVLEQLTISPWNNLMFMIYYGLVIEGESTPQ 107 VAKKVVLEQLT SPWNN +FM+YYGLVIEG + Q Sbjct: 88 VAKKVVLEQLTASPWNNFVFMVYYGLVIEGRNWSQ 122 >ref|XP_002269336.1| PREDICTED: peroxisomal membrane protein PMP22 [Vitis vinifera] gi|147836521|emb|CAN70890.1| hypothetical protein VITISV_000480 [Vitis vinifera] Length = 185 Score = 59.7 bits (143), Expect = 4e-07 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = +3 Query: 3 VAKKVVLEQLTISPWNNLMFMIYYGLVIEGESTPQ 107 VAKKVVLEQLT SPWNN +FM+YYGLVIEG + Q Sbjct: 88 VAKKVVLEQLTASPWNNFVFMVYYGLVIEGRNWSQ 122 >gb|EPS74437.1| hypothetical protein M569_00319, partial [Genlisea aurea] Length = 117 Score = 58.9 bits (141), Expect = 7e-07 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = +3 Query: 3 VAKKVVLEQLTISPWNNLMFMIYYGLVIEG 92 VAKKVVLEQLT SPWNN +FMIYYGLVIEG Sbjct: 88 VAKKVVLEQLTSSPWNNFLFMIYYGLVIEG 117 >ref|XP_003573232.1| PREDICTED: peroxisomal membrane protein PMP22-like [Brachypodium distachyon] Length = 183 Score = 58.5 bits (140), Expect = 9e-07 Identities = 24/34 (70%), Positives = 30/34 (88%) Frame = +3 Query: 6 AKKVVLEQLTISPWNNLMFMIYYGLVIEGESTPQ 107 AKKV++EQLT+SPWNN+MFM+YYGLV+EG Q Sbjct: 86 AKKVIVEQLTVSPWNNMMFMMYYGLVVEGRPFTQ 119 >ref|XP_006489679.1| PREDICTED: peroxisomal membrane protein PMP22-like [Citrus sinensis] Length = 185 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = +3 Query: 3 VAKKVVLEQLTISPWNNLMFMIYYGLVIEGES 98 VAKKV+LEQLT SPWNN +FM+YYGLV+EG S Sbjct: 88 VAKKVLLEQLTSSPWNNFLFMMYYGLVVEGRS 119 >ref|XP_006420288.1| hypothetical protein CICLE_v10007209mg [Citrus clementina] gi|567854339|ref|XP_006420289.1| hypothetical protein CICLE_v10007209mg [Citrus clementina] gi|567854341|ref|XP_006420290.1| hypothetical protein CICLE_v10007209mg [Citrus clementina] gi|557522161|gb|ESR33528.1| hypothetical protein CICLE_v10007209mg [Citrus clementina] gi|557522162|gb|ESR33529.1| hypothetical protein CICLE_v10007209mg [Citrus clementina] gi|557522163|gb|ESR33530.1| hypothetical protein CICLE_v10007209mg [Citrus clementina] Length = 185 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = +3 Query: 3 VAKKVVLEQLTISPWNNLMFMIYYGLVIEGES 98 VAKKV+LEQLT SPWNN +FM+YYGLV+EG S Sbjct: 88 VAKKVLLEQLTSSPWNNFLFMMYYGLVVEGRS 119 >ref|XP_003534581.1| PREDICTED: peroxisomal membrane protein PMP22-like [Glycine max] Length = 185 Score = 57.8 bits (138), Expect = 2e-06 Identities = 24/31 (77%), Positives = 30/31 (96%) Frame = +3 Query: 3 VAKKVVLEQLTISPWNNLMFMIYYGLVIEGE 95 VAKKV++EQLT +PWNNL+FMIYYGLV+EG+ Sbjct: 88 VAKKVLIEQLTSNPWNNLLFMIYYGLVVEGQ 118 >dbj|BAJ92860.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 189 Score = 57.8 bits (138), Expect = 2e-06 Identities = 22/29 (75%), Positives = 29/29 (100%) Frame = +3 Query: 6 AKKVVLEQLTISPWNNLMFMIYYGLVIEG 92 AKKV++EQLT+SPWNN+MFM+YYGL++EG Sbjct: 90 AKKVIVEQLTVSPWNNMMFMMYYGLIVEG 118 >dbj|BAJ86876.1| predicted protein [Hordeum vulgare subsp. vulgare] gi|326528083|dbj|BAJ89093.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 189 Score = 57.8 bits (138), Expect = 2e-06 Identities = 22/29 (75%), Positives = 29/29 (100%) Frame = +3 Query: 6 AKKVVLEQLTISPWNNLMFMIYYGLVIEG 92 AKKV++EQLT+SPWNN+MFM+YYGL++EG Sbjct: 90 AKKVIVEQLTVSPWNNMMFMMYYGLIVEG 118 >gb|ACU19135.1| unknown [Glycine max] Length = 185 Score = 57.8 bits (138), Expect = 2e-06 Identities = 24/31 (77%), Positives = 30/31 (96%) Frame = +3 Query: 3 VAKKVVLEQLTISPWNNLMFMIYYGLVIEGE 95 VAKKV++EQLT +PWNNL+FMIYYGLV+EG+ Sbjct: 88 VAKKVLIEQLTSNPWNNLLFMIYYGLVVEGQ 118 >ref|NP_001237804.1| uncharacterized protein LOC100499909 [Glycine max] gi|255627583|gb|ACU14136.1| unknown [Glycine max] Length = 185 Score = 57.8 bits (138), Expect = 2e-06 Identities = 24/31 (77%), Positives = 30/31 (96%) Frame = +3 Query: 3 VAKKVVLEQLTISPWNNLMFMIYYGLVIEGE 95 VAKKV++EQLT +PWNNL+FMIYYGLV+EG+ Sbjct: 88 VAKKVLIEQLTSNPWNNLLFMIYYGLVVEGQ 118 >ref|XP_002285350.1| PREDICTED: peroxisomal membrane protein PMP22 [Vitis vinifera] gi|296083689|emb|CBI23678.3| unnamed protein product [Vitis vinifera] Length = 185 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +3 Query: 3 VAKKVVLEQLTISPWNNLMFMIYYGLVIEG 92 VAKKVVLEQLT SPWNN+ FM+YYGLV+EG Sbjct: 88 VAKKVVLEQLTSSPWNNMFFMMYYGLVVEG 117 >emb|CAN76530.1| hypothetical protein VITISV_012682 [Vitis vinifera] Length = 185 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +3 Query: 3 VAKKVVLEQLTISPWNNLMFMIYYGLVIEG 92 VAKKVVLEQLT SPWNN+ FM+YYGLV+EG Sbjct: 88 VAKKVVLEQLTSSPWNNMFFMMYYGLVVEG 117 >gb|EYU33886.1| hypothetical protein MIMGU_mgv1a014552mg [Mimulus guttatus] Length = 186 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/30 (80%), Positives = 29/30 (96%) Frame = +3 Query: 3 VAKKVVLEQLTISPWNNLMFMIYYGLVIEG 92 VAKKV+LEQLT SPWNN++FM+YYGLV+EG Sbjct: 89 VAKKVMLEQLTSSPWNNMVFMLYYGLVVEG 118 >ref|XP_006343281.1| PREDICTED: peroxisomal membrane protein PMP22-like [Solanum tuberosum] Length = 185 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = +3 Query: 3 VAKKVVLEQLTISPWNNLMFMIYYGLVIE 89 VAKKVVLEQ+T SPWNNL+FMIYYGLVIE Sbjct: 88 VAKKVVLEQVTSSPWNNLLFMIYYGLVIE 116 >ref|XP_007147711.1| hypothetical protein PHAVU_006G148300g [Phaseolus vulgaris] gi|561020934|gb|ESW19705.1| hypothetical protein PHAVU_006G148300g [Phaseolus vulgaris] Length = 185 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = +3 Query: 3 VAKKVVLEQLTISPWNNLMFMIYYGLVIEGE 95 VAKKV++EQ T SPWNNL+FMIYYGLV+EG+ Sbjct: 88 VAKKVLIEQCTSSPWNNLLFMIYYGLVVEGQ 118