BLASTX nr result
ID: Mentha26_contig00009569
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00009569 (415 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU20799.1| hypothetical protein MIMGU_mgv1a000831mg [Mimulus... 62 8e-08 >gb|EYU20799.1| hypothetical protein MIMGU_mgv1a000831mg [Mimulus guttatus] Length = 970 Score = 62.0 bits (149), Expect = 8e-08 Identities = 29/57 (50%), Positives = 37/57 (64%) Frame = +1 Query: 1 SFNQVGPMIHSVNTSNGPNEIASFPFPGKQALSLQVPSENHRDWQNYPYLEHMKPQE 171 S NQ G + S + SN P +A+FPFPGKQ ++ V SEN WQ+Y + EHMK QE Sbjct: 884 SINQPGLNLPSASKSNDPMGVAAFPFPGKQVSTVPVQSENLNGWQDYYFFEHMKEQE 940