BLASTX nr result
ID: Mentha26_contig00009506
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00009506 (320 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU34083.1| hypothetical protein MIMGU_mgv1a000040mg [Mimulus... 61 1e-07 gb|EXC20615.1| hypothetical protein L484_027170 [Morus notabilis] 56 4e-06 >gb|EYU34083.1| hypothetical protein MIMGU_mgv1a000040mg [Mimulus guttatus] Length = 2172 Score = 61.2 bits (147), Expect = 1e-07 Identities = 30/53 (56%), Positives = 36/53 (67%) Frame = +3 Query: 3 FLCNPLISNLYWMVVKSHERCLGESDSETAENLSQKRRENDSNWGEFNPYFLL 161 FL NPLI NLY ++VKSHE+C G + +NL R DS+W EFNPYFLL Sbjct: 2123 FLGNPLIYNLYSVLVKSHEKCFGRN----GDNLGGNWRRGDSDWVEFNPYFLL 2171 >gb|EXC20615.1| hypothetical protein L484_027170 [Morus notabilis] Length = 2199 Score = 56.2 bits (134), Expect = 4e-06 Identities = 29/53 (54%), Positives = 38/53 (71%) Frame = +3 Query: 3 FLCNPLISNLYWMVVKSHERCLGESDSETAENLSQKRRENDSNWGEFNPYFLL 161 FL NPLISNLY +VVKSHE+ +G ET ++L RE+++ W F+PYFLL Sbjct: 2150 FLGNPLISNLYLLVVKSHEKVVG----ETIKDLIPGSREDNAIWDGFDPYFLL 2198