BLASTX nr result
ID: Mentha26_contig00009431
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00009431 (427 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN62820.1| hypothetical protein VITISV_013243 [Vitis vinifera] 47 1e-05 >emb|CAN62820.1| hypothetical protein VITISV_013243 [Vitis vinifera] Length = 1528 Score = 46.6 bits (109), Expect(2) = 1e-05 Identities = 17/44 (38%), Positives = 25/44 (56%) Frame = -1 Query: 241 KLMGGLWTCVVWTIWKWRNVVAFEGSDWNF*KIEMKIKCRFWSW 110 K+ + C+ WT+WK RN +AF G + N K++ C WSW Sbjct: 1463 KIWKSIPLCIFWTVWKERNRLAFRGGELNIQKLKNSFVCSLWSW 1506 Score = 28.1 bits (61), Expect(2) = 1e-05 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -2 Query: 417 CCCCNAELETAQHLFLLCPAIAHVWNCVVLG 325 C C E ET HL + C + +W+ +VLG Sbjct: 1404 CFLCGCEEETVNHLLIHCIVVRVLWD-IVLG 1433