BLASTX nr result
ID: Mentha26_contig00009375
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00009375 (440 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002525577.1| conserved hypothetical protein [Ricinus comm... 80 4e-13 ref|XP_003634894.1| PREDICTED: uncharacterized protein LOC100853... 79 5e-13 emb|CBI25807.3| unnamed protein product [Vitis vinifera] 79 5e-13 ref|XP_006432331.1| hypothetical protein CICLE_v10002366mg [Citr... 77 2e-12 ref|XP_006432330.1| hypothetical protein CICLE_v10002366mg [Citr... 77 2e-12 ref|XP_002264033.2| PREDICTED: uncharacterized protein LOC100263... 77 2e-12 emb|CBI40627.3| unnamed protein product [Vitis vinifera] 77 2e-12 ref|XP_002266876.2| PREDICTED: uncharacterized protein LOC100249... 77 2e-12 emb|CBI25812.3| unnamed protein product [Vitis vinifera] 77 2e-12 ref|XP_003634874.1| PREDICTED: uncharacterized protein LOC100854... 77 2e-12 ref|XP_002272522.1| PREDICTED: uncharacterized protein LOC100250... 77 2e-12 emb|CAN84094.1| hypothetical protein VITISV_022547 [Vitis vinifera] 77 2e-12 ref|XP_007010705.1| Uncharacterized protein isoform 2 [Theobroma... 77 2e-12 ref|XP_004516534.1| PREDICTED: uncharacterized protein LOC101500... 76 4e-12 ref|XP_004516532.1| PREDICTED: uncharacterized protein LOC101500... 76 4e-12 ref|XP_004516531.1| PREDICTED: uncharacterized protein LOC101500... 76 4e-12 ref|XP_004516530.1| PREDICTED: uncharacterized protein LOC101500... 76 4e-12 ref|XP_004516529.1| PREDICTED: uncharacterized protein LOC101500... 76 4e-12 ref|XP_003522871.1| PREDICTED: uncharacterized protein LOC100814... 76 4e-12 ref|XP_006361183.1| PREDICTED: uncharacterized protein LOC102578... 76 6e-12 >ref|XP_002525577.1| conserved hypothetical protein [Ricinus communis] gi|223535156|gb|EEF36836.1| conserved hypothetical protein [Ricinus communis] Length = 237 Score = 79.7 bits (195), Expect = 4e-13 Identities = 37/51 (72%), Positives = 43/51 (84%) Frame = -3 Query: 438 ALALAPFVLRGLSWFTIKFGFGTQGKAVTAISGICFGLAFLMFVIVTLLWA 286 ALALAPFV RGLSWFT+KF F +QGKA AI G C GLAF++F++VTLLWA Sbjct: 187 ALALAPFVDRGLSWFTLKFKFESQGKAFMAIVGFCLGLAFILFLVVTLLWA 237 >ref|XP_003634894.1| PREDICTED: uncharacterized protein LOC100853368 [Vitis vinifera] Length = 125 Score = 79.3 bits (194), Expect = 5e-13 Identities = 38/51 (74%), Positives = 42/51 (82%) Frame = -3 Query: 438 ALALAPFVLRGLSWFTIKFGFGTQGKAVTAISGICFGLAFLMFVIVTLLWA 286 ALALAP V RGLSWFT+KF F +QGKA TAI G CFGLA ++F IVTLLWA Sbjct: 75 ALALAPIVDRGLSWFTLKFKFESQGKAFTAIVGFCFGLALILFFIVTLLWA 125 >emb|CBI25807.3| unnamed protein product [Vitis vinifera] Length = 153 Score = 79.3 bits (194), Expect = 5e-13 Identities = 38/51 (74%), Positives = 42/51 (82%) Frame = -3 Query: 438 ALALAPFVLRGLSWFTIKFGFGTQGKAVTAISGICFGLAFLMFVIVTLLWA 286 ALALAP V RGLSWFT+KF F +QGKA TAI G CFGLA ++F IVTLLWA Sbjct: 103 ALALAPIVDRGLSWFTLKFKFESQGKAFTAIVGFCFGLALILFFIVTLLWA 153 >ref|XP_006432331.1| hypothetical protein CICLE_v10002366mg [Citrus clementina] gi|557534453|gb|ESR45571.1| hypothetical protein CICLE_v10002366mg [Citrus clementina] Length = 221 Score = 77.4 bits (189), Expect = 2e-12 Identities = 37/51 (72%), Positives = 41/51 (80%) Frame = -3 Query: 438 ALALAPFVLRGLSWFTIKFGFGTQGKAVTAISGICFGLAFLMFVIVTLLWA 286 ALALAP V RGLSWFT+KF F TQGKA AI G CFGLA ++F+ VTLLWA Sbjct: 171 ALALAPLVDRGLSWFTVKFKFQTQGKAFMAIVGFCFGLAVILFLAVTLLWA 221 >ref|XP_006432330.1| hypothetical protein CICLE_v10002366mg [Citrus clementina] gi|568834248|ref|XP_006471257.1| PREDICTED: uncharacterized protein LOC102618398 [Citrus sinensis] gi|557534452|gb|ESR45570.1| hypothetical protein CICLE_v10002366mg [Citrus clementina] Length = 230 Score = 77.4 bits (189), Expect = 2e-12 Identities = 37/51 (72%), Positives = 41/51 (80%) Frame = -3 Query: 438 ALALAPFVLRGLSWFTIKFGFGTQGKAVTAISGICFGLAFLMFVIVTLLWA 286 ALALAP V RGLSWFT+KF F TQGKA AI G CFGLA ++F+ VTLLWA Sbjct: 180 ALALAPLVDRGLSWFTVKFKFQTQGKAFMAIVGFCFGLAVILFLAVTLLWA 230 >ref|XP_002264033.2| PREDICTED: uncharacterized protein LOC100263253 [Vitis vinifera] Length = 125 Score = 77.4 bits (189), Expect = 2e-12 Identities = 37/51 (72%), Positives = 41/51 (80%) Frame = -3 Query: 438 ALALAPFVLRGLSWFTIKFGFGTQGKAVTAISGICFGLAFLMFVIVTLLWA 286 ALALAP V RGLSWFT+KF F +QGKA AI G CFGLA ++F IVTLLWA Sbjct: 75 ALALAPIVDRGLSWFTVKFKFESQGKAFMAIVGFCFGLALILFFIVTLLWA 125 >emb|CBI40627.3| unnamed protein product [Vitis vinifera] Length = 82 Score = 77.4 bits (189), Expect = 2e-12 Identities = 37/51 (72%), Positives = 41/51 (80%) Frame = -3 Query: 438 ALALAPFVLRGLSWFTIKFGFGTQGKAVTAISGICFGLAFLMFVIVTLLWA 286 ALALAP V RGLSWFT+KF F +QGKA AI G CFGLA ++F IVTLLWA Sbjct: 32 ALALAPIVDRGLSWFTVKFKFESQGKAFMAIVGFCFGLALILFFIVTLLWA 82 >ref|XP_002266876.2| PREDICTED: uncharacterized protein LOC100249912 [Vitis vinifera] gi|298205097|emb|CBI40618.3| unnamed protein product [Vitis vinifera] Length = 153 Score = 77.4 bits (189), Expect = 2e-12 Identities = 37/51 (72%), Positives = 41/51 (80%) Frame = -3 Query: 438 ALALAPFVLRGLSWFTIKFGFGTQGKAVTAISGICFGLAFLMFVIVTLLWA 286 ALALAP V RGLSWFT+KF F +QGKA AI G CFGLA ++F IVTLLWA Sbjct: 103 ALALAPIVDRGLSWFTVKFKFESQGKAFMAIVGFCFGLALILFFIVTLLWA 153 >emb|CBI25812.3| unnamed protein product [Vitis vinifera] Length = 213 Score = 77.4 bits (189), Expect = 2e-12 Identities = 37/51 (72%), Positives = 41/51 (80%) Frame = -3 Query: 438 ALALAPFVLRGLSWFTIKFGFGTQGKAVTAISGICFGLAFLMFVIVTLLWA 286 ALALAP V RGLSWFT+KF F +QGKA AI G CFGLA ++F IVTLLWA Sbjct: 163 ALALAPIVDRGLSWFTVKFKFESQGKAFMAIVGFCFGLALILFFIVTLLWA 213 >ref|XP_003634874.1| PREDICTED: uncharacterized protein LOC100854570 [Vitis vinifera] gi|298205115|emb|CBI40636.3| unnamed protein product [Vitis vinifera] Length = 113 Score = 77.4 bits (189), Expect = 2e-12 Identities = 37/51 (72%), Positives = 41/51 (80%) Frame = -3 Query: 438 ALALAPFVLRGLSWFTIKFGFGTQGKAVTAISGICFGLAFLMFVIVTLLWA 286 ALALAP V RGLSWFT+KF F +QGKA AI G CFGLA ++F IVTLLWA Sbjct: 63 ALALAPIVDRGLSWFTVKFKFESQGKAFMAIVGFCFGLALILFFIVTLLWA 113 >ref|XP_002272522.1| PREDICTED: uncharacterized protein LOC100250564 [Vitis vinifera] Length = 215 Score = 77.4 bits (189), Expect = 2e-12 Identities = 37/51 (72%), Positives = 41/51 (80%) Frame = -3 Query: 438 ALALAPFVLRGLSWFTIKFGFGTQGKAVTAISGICFGLAFLMFVIVTLLWA 286 ALALAP V RGLSWFT+KF F +QGKA AI G CFGLA ++F IVTLLWA Sbjct: 165 ALALAPIVDRGLSWFTVKFKFESQGKAFMAIVGFCFGLALILFFIVTLLWA 215 >emb|CAN84094.1| hypothetical protein VITISV_022547 [Vitis vinifera] Length = 132 Score = 77.4 bits (189), Expect = 2e-12 Identities = 37/51 (72%), Positives = 41/51 (80%) Frame = -3 Query: 438 ALALAPFVLRGLSWFTIKFGFGTQGKAVTAISGICFGLAFLMFVIVTLLWA 286 ALALAP V RGLSWFT+KF F +QGKA AI G CFGLA ++F IVTLLWA Sbjct: 82 ALALAPIVDRGLSWFTVKFKFESQGKAFMAIVGFCFGLALILFFIVTLLWA 132 >ref|XP_007010705.1| Uncharacterized protein isoform 2 [Theobroma cacao] gi|508727618|gb|EOY19515.1| Uncharacterized protein isoform 2 [Theobroma cacao] Length = 243 Score = 77.0 bits (188), Expect = 2e-12 Identities = 35/51 (68%), Positives = 42/51 (82%) Frame = -3 Query: 438 ALALAPFVLRGLSWFTIKFGFGTQGKAVTAISGICFGLAFLMFVIVTLLWA 286 ALALAPFV R LSWFT+KF F +QGKA I G CFGLAF++F++VT+LWA Sbjct: 193 ALALAPFVDRALSWFTVKFKFESQGKASMVIIGFCFGLAFMLFLVVTVLWA 243 >ref|XP_004516534.1| PREDICTED: uncharacterized protein LOC101500524 isoform X6 [Cicer arietinum] Length = 154 Score = 76.3 bits (186), Expect = 4e-12 Identities = 35/51 (68%), Positives = 42/51 (82%) Frame = -3 Query: 438 ALALAPFVLRGLSWFTIKFGFGTQGKAVTAISGICFGLAFLMFVIVTLLWA 286 ALA+APFV RGLSWFT KF F +QGKA AI G CFGLA ++F+++TLLWA Sbjct: 104 ALAMAPFVDRGLSWFTDKFKFQSQGKAFMAIVGFCFGLALIVFLVITLLWA 154 >ref|XP_004516532.1| PREDICTED: uncharacterized protein LOC101500524 isoform X4 [Cicer arietinum] Length = 217 Score = 76.3 bits (186), Expect = 4e-12 Identities = 35/51 (68%), Positives = 42/51 (82%) Frame = -3 Query: 438 ALALAPFVLRGLSWFTIKFGFGTQGKAVTAISGICFGLAFLMFVIVTLLWA 286 ALA+APFV RGLSWFT KF F +QGKA AI G CFGLA ++F+++TLLWA Sbjct: 167 ALAMAPFVDRGLSWFTDKFKFQSQGKAFMAIVGFCFGLALIVFLVITLLWA 217 >ref|XP_004516531.1| PREDICTED: uncharacterized protein LOC101500524 isoform X3 [Cicer arietinum] Length = 219 Score = 76.3 bits (186), Expect = 4e-12 Identities = 35/51 (68%), Positives = 42/51 (82%) Frame = -3 Query: 438 ALALAPFVLRGLSWFTIKFGFGTQGKAVTAISGICFGLAFLMFVIVTLLWA 286 ALA+APFV RGLSWFT KF F +QGKA AI G CFGLA ++F+++TLLWA Sbjct: 169 ALAMAPFVDRGLSWFTDKFKFQSQGKAFMAIVGFCFGLALIVFLVITLLWA 219 >ref|XP_004516530.1| PREDICTED: uncharacterized protein LOC101500524 isoform X2 [Cicer arietinum] Length = 220 Score = 76.3 bits (186), Expect = 4e-12 Identities = 35/51 (68%), Positives = 42/51 (82%) Frame = -3 Query: 438 ALALAPFVLRGLSWFTIKFGFGTQGKAVTAISGICFGLAFLMFVIVTLLWA 286 ALA+APFV RGLSWFT KF F +QGKA AI G CFGLA ++F+++TLLWA Sbjct: 170 ALAMAPFVDRGLSWFTDKFKFQSQGKAFMAIVGFCFGLALIVFLVITLLWA 220 >ref|XP_004516529.1| PREDICTED: uncharacterized protein LOC101500524 isoform X1 [Cicer arietinum] Length = 222 Score = 76.3 bits (186), Expect = 4e-12 Identities = 35/51 (68%), Positives = 42/51 (82%) Frame = -3 Query: 438 ALALAPFVLRGLSWFTIKFGFGTQGKAVTAISGICFGLAFLMFVIVTLLWA 286 ALA+APFV RGLSWFT KF F +QGKA AI G CFGLA ++F+++TLLWA Sbjct: 172 ALAMAPFVDRGLSWFTDKFKFQSQGKAFMAIVGFCFGLALIVFLVITLLWA 222 >ref|XP_003522871.1| PREDICTED: uncharacterized protein LOC100814328 [Glycine max] Length = 224 Score = 76.3 bits (186), Expect = 4e-12 Identities = 36/51 (70%), Positives = 41/51 (80%) Frame = -3 Query: 438 ALALAPFVLRGLSWFTIKFGFGTQGKAVTAISGICFGLAFLMFVIVTLLWA 286 ALALAPFV RGLSWFT KF F TQGKA AI G+C GLA ++F ++TLLWA Sbjct: 174 ALALAPFVDRGLSWFTHKFKFQTQGKAFMAIVGLCLGLALIVFFVITLLWA 224 >ref|XP_006361183.1| PREDICTED: uncharacterized protein LOC102578377 isoform X4 [Solanum tuberosum] Length = 179 Score = 75.9 bits (185), Expect = 6e-12 Identities = 34/51 (66%), Positives = 41/51 (80%) Frame = -3 Query: 438 ALALAPFVLRGLSWFTIKFGFGTQGKAVTAISGICFGLAFLMFVIVTLLWA 286 ALALAPFV GLSWFT K F +QGKA ++G CFGLAF++F+I+TLLWA Sbjct: 129 ALALAPFVDTGLSWFTTKMKFESQGKAFAVVAGFCFGLAFMLFLIITLLWA 179