BLASTX nr result
ID: Mentha26_contig00009064
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00009064 (476 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFK43955.1| unknown [Lotus japonicus] 69 5e-10 ref|XP_003588785.1| 14 kDa proline-rich protein DC2.15 [Medicago... 69 5e-10 ref|XP_003588784.1| 14 kDa proline-rich protein DC2.15 [Medicago... 69 7e-10 ref|XP_003588779.1| 14 kDa proline-rich protein DC2.15 [Medicago... 69 7e-10 ref|NP_001235098.1| proline-rich protein precursor [Glycine max]... 69 7e-10 gb|EXB54485.1| hypothetical protein L484_019046 [Morus notabilis] 69 9e-10 ref|XP_007161198.1| hypothetical protein PHAVU_001G050300g [Phas... 69 9e-10 ref|XP_007011824.1| Bimodular protein [Theobroma cacao] gi|50878... 69 9e-10 ref|XP_007039886.1| 14 kDa proline-rich protein DC2.15, putative... 69 9e-10 ref|XP_004498751.1| PREDICTED: 14 kDa proline-rich protein DC2.1... 69 9e-10 ref|XP_004291444.1| PREDICTED: 14 kDa proline-rich protein DC2.1... 68 1e-09 gb|AAA32650.1| bimodular protein [Medicago sativa] 68 1e-09 gb|ABQ01426.1| bimodular protein [Medicago falcata] 68 1e-09 gb|EYU30296.1| hypothetical protein MIMGU_mgv1a015783mg [Mimulus... 68 1e-09 ref|XP_003588783.1| 14 kDa proline-rich protein DC2.15 [Medicago... 68 1e-09 gb|ADW80126.1| hybrid proline-rich protein [Gossypium hirsutum] 67 2e-09 ref|XP_007137003.1| hypothetical protein PHAVU_009G092000g [Phas... 67 3e-09 ref|XP_007052129.1| Bifunctional inhibitor/lipid-transfer protei... 67 3e-09 ref|XP_003526352.1| PREDICTED: extensin-like [Glycine max] 67 3e-09 ref|XP_003603362.1| Proline-rich protein [Medicago truncatula] g... 67 3e-09 >gb|AFK43955.1| unknown [Lotus japonicus] Length = 128 Score = 69.3 bits (168), Expect = 5e-10 Identities = 29/37 (78%), Positives = 36/37 (97%) Frame = -3 Query: 474 CTAIKANILGINLNVPISLSLILSACQRNVPSGFQCA 364 CTA+KAN+LGINLNVP++LS++LSACQ+ VPSGFQCA Sbjct: 92 CTAVKANVLGINLNVPVTLSVLLSACQKTVPSGFQCA 128 >ref|XP_003588785.1| 14 kDa proline-rich protein DC2.15 [Medicago truncatula] gi|355477833|gb|AES59036.1| 14 kDa proline-rich protein DC2.15 [Medicago truncatula] gi|388496896|gb|AFK36514.1| unknown [Medicago truncatula] gi|388514065|gb|AFK45094.1| unknown [Medicago truncatula] Length = 151 Score = 69.3 bits (168), Expect = 5e-10 Identities = 30/37 (81%), Positives = 37/37 (100%) Frame = -3 Query: 474 CTAIKANILGINLNVPISLSLILSACQRNVPSGFQCA 364 CTAIKAN+LGINLNVPI+LSL+LSAC+++VPSGFQC+ Sbjct: 115 CTAIKANVLGINLNVPITLSLLLSACEKSVPSGFQCS 151 >ref|XP_003588784.1| 14 kDa proline-rich protein DC2.15 [Medicago truncatula] gi|355477832|gb|AES59035.1| 14 kDa proline-rich protein DC2.15 [Medicago truncatula] Length = 164 Score = 68.9 bits (167), Expect = 7e-10 Identities = 29/37 (78%), Positives = 37/37 (100%) Frame = -3 Query: 474 CTAIKANILGINLNVPISLSLILSACQRNVPSGFQCA 364 CTAIKAN+LGINLNVP++LSL+LSACQ++VP+GFQC+ Sbjct: 128 CTAIKANVLGINLNVPVTLSLLLSACQKSVPNGFQCS 164 >ref|XP_003588779.1| 14 kDa proline-rich protein DC2.15 [Medicago truncatula] gi|355477827|gb|AES59030.1| 14 kDa proline-rich protein DC2.15 [Medicago truncatula] Length = 210 Score = 68.9 bits (167), Expect = 7e-10 Identities = 29/37 (78%), Positives = 37/37 (100%) Frame = -3 Query: 474 CTAIKANILGINLNVPISLSLILSACQRNVPSGFQCA 364 CTAIKAN+LGINLNVP++LSL+LSACQ++VP+GFQC+ Sbjct: 174 CTAIKANVLGINLNVPVTLSLLLSACQKSVPNGFQCS 210 >ref|NP_001235098.1| proline-rich protein precursor [Glycine max] gi|8745402|gb|AAF78903.1|AF248055_1 proline-rich protein [Glycine max] gi|255626347|gb|ACU13518.1| unknown [Glycine max] Length = 126 Score = 68.9 bits (167), Expect = 7e-10 Identities = 30/37 (81%), Positives = 36/37 (97%) Frame = -3 Query: 474 CTAIKANILGINLNVPISLSLILSACQRNVPSGFQCA 364 CTAIKAN+LGINLNVPI+LS++LSACQ+ VP+GFQCA Sbjct: 90 CTAIKANVLGINLNVPITLSVLLSACQKTVPAGFQCA 126 >gb|EXB54485.1| hypothetical protein L484_019046 [Morus notabilis] Length = 114 Score = 68.6 bits (166), Expect = 9e-10 Identities = 29/37 (78%), Positives = 36/37 (97%) Frame = -3 Query: 474 CTAIKANILGINLNVPISLSLILSACQRNVPSGFQCA 364 CTAIKANILGINLN+PISLSL++S C++++PSGFQCA Sbjct: 78 CTAIKANILGINLNIPISLSLLISTCRKDIPSGFQCA 114 >ref|XP_007161198.1| hypothetical protein PHAVU_001G050300g [Phaseolus vulgaris] gi|561034662|gb|ESW33192.1| hypothetical protein PHAVU_001G050300g [Phaseolus vulgaris] Length = 121 Score = 68.6 bits (166), Expect = 9e-10 Identities = 30/36 (83%), Positives = 35/36 (97%) Frame = -3 Query: 474 CTAIKANILGINLNVPISLSLILSACQRNVPSGFQC 367 CTAIKAN+LGINLNVPI+LS++LSACQ+ VPSGFQC Sbjct: 85 CTAIKANVLGINLNVPITLSVLLSACQKTVPSGFQC 120 >ref|XP_007011824.1| Bimodular protein [Theobroma cacao] gi|508782187|gb|EOY29443.1| Bimodular protein [Theobroma cacao] Length = 133 Score = 68.6 bits (166), Expect = 9e-10 Identities = 29/36 (80%), Positives = 36/36 (100%) Frame = -3 Query: 474 CTAIKANILGINLNVPISLSLILSACQRNVPSGFQC 367 CTAIKA++LGINLN+P+SLSLILSACQ+NVP+GF+C Sbjct: 97 CTAIKASVLGINLNIPVSLSLILSACQKNVPAGFKC 132 >ref|XP_007039886.1| 14 kDa proline-rich protein DC2.15, putative [Theobroma cacao] gi|508777131|gb|EOY24387.1| 14 kDa proline-rich protein DC2.15, putative [Theobroma cacao] Length = 140 Score = 68.6 bits (166), Expect = 9e-10 Identities = 29/37 (78%), Positives = 35/37 (94%) Frame = -3 Query: 474 CTAIKANILGINLNVPISLSLILSACQRNVPSGFQCA 364 CTAIKANILGINLN+P+SLSL+L+ C +NVPSGFQC+ Sbjct: 104 CTAIKANILGINLNIPVSLSLLLNVCSKNVPSGFQCS 140 >ref|XP_004498751.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Cicer arietinum] Length = 126 Score = 68.6 bits (166), Expect = 9e-10 Identities = 29/37 (78%), Positives = 37/37 (100%) Frame = -3 Query: 474 CTAIKANILGINLNVPISLSLILSACQRNVPSGFQCA 364 CTAIKAN+LGINLNVPI+LSL+LSACQ+++PSGF+C+ Sbjct: 90 CTAIKANVLGINLNVPITLSLLLSACQKSIPSGFKCS 126 >ref|XP_004291444.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Fragaria vesca subsp. vesca] Length = 133 Score = 68.2 bits (165), Expect = 1e-09 Identities = 29/36 (80%), Positives = 36/36 (100%) Frame = -3 Query: 474 CTAIKANILGINLNVPISLSLILSACQRNVPSGFQC 367 CTA+KAN+LGINLNVPISLS+++SACQ++VPSGFQC Sbjct: 97 CTALKANVLGINLNVPISLSVLVSACQKSVPSGFQC 132 >gb|AAA32650.1| bimodular protein [Medicago sativa] Length = 166 Score = 68.2 bits (165), Expect = 1e-09 Identities = 29/37 (78%), Positives = 37/37 (100%) Frame = -3 Query: 474 CTAIKANILGINLNVPISLSLILSACQRNVPSGFQCA 364 CTAIKANILGINLNVPI+LSL+LSAC++++P+GFQC+ Sbjct: 130 CTAIKANILGINLNVPITLSLLLSACEKSIPNGFQCS 166 >gb|ABQ01426.1| bimodular protein [Medicago falcata] Length = 166 Score = 68.2 bits (165), Expect = 1e-09 Identities = 29/37 (78%), Positives = 37/37 (100%) Frame = -3 Query: 474 CTAIKANILGINLNVPISLSLILSACQRNVPSGFQCA 364 CTAIKANILGINLNVPI+LSL+LSAC++++P+GFQC+ Sbjct: 130 CTAIKANILGINLNVPITLSLLLSACEKSIPNGFQCS 166 >gb|EYU30296.1| hypothetical protein MIMGU_mgv1a015783mg [Mimulus guttatus] Length = 146 Score = 67.8 bits (164), Expect = 1e-09 Identities = 29/37 (78%), Positives = 34/37 (91%) Frame = -3 Query: 474 CTAIKANILGINLNVPISLSLILSACQRNVPSGFQCA 364 CTAIKAN+LGINLNVPISLSL+L+ C +N+P GFQCA Sbjct: 110 CTAIKANVLGINLNVPISLSLLLNVCSKNIPPGFQCA 146 >ref|XP_003588783.1| 14 kDa proline-rich protein DC2.15 [Medicago truncatula] gi|355477831|gb|AES59034.1| 14 kDa proline-rich protein DC2.15 [Medicago truncatula] Length = 154 Score = 67.8 bits (164), Expect = 1e-09 Identities = 28/37 (75%), Positives = 37/37 (100%) Frame = -3 Query: 474 CTAIKANILGINLNVPISLSLILSACQRNVPSGFQCA 364 CTAIKAN+LGINLNVP++LSL+LSAC+++VP+GFQC+ Sbjct: 118 CTAIKANVLGINLNVPVTLSLLLSACEKSVPNGFQCS 154 >gb|ADW80126.1| hybrid proline-rich protein [Gossypium hirsutum] Length = 122 Score = 67.4 bits (163), Expect = 2e-09 Identities = 29/36 (80%), Positives = 34/36 (94%) Frame = -3 Query: 474 CTAIKANILGINLNVPISLSLILSACQRNVPSGFQC 367 CTAIKAN+LGINLN+P+SLSLILSACQ+ VP GF+C Sbjct: 86 CTAIKANVLGINLNIPVSLSLILSACQKEVPPGFKC 121 >ref|XP_007137003.1| hypothetical protein PHAVU_009G092000g [Phaseolus vulgaris] gi|561010090|gb|ESW08997.1| hypothetical protein PHAVU_009G092000g [Phaseolus vulgaris] Length = 162 Score = 67.0 bits (162), Expect = 3e-09 Identities = 29/37 (78%), Positives = 35/37 (94%) Frame = -3 Query: 474 CTAIKANILGINLNVPISLSLILSACQRNVPSGFQCA 364 CTAIKAN+LGINLNVP++LS ILSACQ+ VPSGF+C+ Sbjct: 126 CTAIKANVLGINLNVPVALSAILSACQKTVPSGFKCS 162 >ref|XP_007052129.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein [Theobroma cacao] gi|508704390|gb|EOX96286.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein [Theobroma cacao] Length = 139 Score = 67.0 bits (162), Expect = 3e-09 Identities = 30/37 (81%), Positives = 34/37 (91%) Frame = -3 Query: 474 CTAIKANILGINLNVPISLSLILSACQRNVPSGFQCA 364 CTAIKANILGINLNVP+SLSL+L+ C +NVP GFQCA Sbjct: 103 CTAIKANILGINLNVPVSLSLLLNYCGKNVPKGFQCA 139 >ref|XP_003526352.1| PREDICTED: extensin-like [Glycine max] Length = 221 Score = 67.0 bits (162), Expect = 3e-09 Identities = 29/36 (80%), Positives = 34/36 (94%) Frame = -3 Query: 474 CTAIKANILGINLNVPISLSLILSACQRNVPSGFQC 367 CTAIKAN+LGINLNVP++LS+ILSACQ+ VP GFQC Sbjct: 184 CTAIKANVLGINLNVPVTLSVILSACQKTVPPGFQC 219 >ref|XP_003603362.1| Proline-rich protein [Medicago truncatula] gi|217075502|gb|ACJ86111.1| unknown [Medicago truncatula] gi|355492410|gb|AES73613.1| Proline-rich protein [Medicago truncatula] gi|388518451|gb|AFK47287.1| unknown [Medicago truncatula] Length = 130 Score = 67.0 bits (162), Expect = 3e-09 Identities = 29/36 (80%), Positives = 34/36 (94%) Frame = -3 Query: 474 CTAIKANILGINLNVPISLSLILSACQRNVPSGFQC 367 CTA+KAN+LGINLNVPI+LSL+LSACQ+ VP GFQC Sbjct: 94 CTALKANVLGINLNVPITLSLLLSACQKTVPPGFQC 129