BLASTX nr result
ID: Mentha26_contig00009000
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00009000 (518 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU32298.1| hypothetical protein MIMGU_mgv1a000081mg [Mimulus... 72 6e-11 >gb|EYU32298.1| hypothetical protein MIMGU_mgv1a000081mg [Mimulus guttatus] Length = 1870 Score = 72.4 bits (176), Expect = 6e-11 Identities = 41/60 (68%), Positives = 47/60 (78%) Frame = +3 Query: 3 ALYHEKVKQGINISEKGSTSRASTAELPRSKQRRDVKVKGSSARLPLKSNIIFGKEKIRR 182 ALYH+KVK+ I+IS S+SR ST E PR++Q RDVKVKGSS R PLKSN IF KEKI R Sbjct: 1812 ALYHDKVKKRIDIS--ASSSRVSTTEKPRNRQLRDVKVKGSSLRFPLKSN-IFSKEKITR 1868